BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I19 (838 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0382 - 22501041-22501279,22501717-22501810 30 2.0 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 30 2.0 03_06_0471 + 34169562-34169892,34170121-34170347 29 3.5 06_03_0874 - 25580417-25580419,25580504-25580604,25580828-255814... 29 4.6 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 286 DYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFPGARGG 402 D P+ + Y+P + YY DPP Y+ P P P GG Sbjct: 55 DPPPSPDYYDPPHSPDYY-DPPPSPDYYDPPPSPYYGGG 92 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +1 Query: 271 VNPPKDYNPNGNGYEPI---DNGAYYVDPPQGRPYFKPTPFPGARG 399 V PP Y P +G P N + Y +PP GRP P P GA G Sbjct: 404 VRPPSPYMPPPSGPAPPFYGQNQSMY-EPPVGRPNSGPPPSYGAGG 448 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +1 Query: 277 PPKDYNPNGNGYEPIDNGAYYVDPPQG---RPYFKPTPFPG 390 PP Y P+ GY P GAY PP G +P + P +PG Sbjct: 68 PPSGYPPSQGGYPP---GAY---PPSGYPQQPGYPPAGYPG 102 >06_03_0874 - 25580417-25580419,25580504-25580604,25580828-25581411, 25581523-25581594,25581667-25581793,25583412-25583516, 25583643-25583676 Length = 341 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 280 PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKP 375 P P G Y P G Y PP+G+P + P Sbjct: 276 PYPPQPQGQPYPPQPYGQTYPPPPKGQPTYPP 307 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,256,011 Number of Sequences: 37544 Number of extensions: 399341 Number of successful extensions: 708 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -