BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I19 (838 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC068505-1|AAH68505.1| 644|Homo sapiens zinc finger protein 746... 31 3.9 AK128244-1|BAC87351.1| 459|Homo sapiens protein ( Homo sapiens ... 31 3.9 AK055975-1|BAB71061.1| 242|Homo sapiens protein ( Homo sapiens ... 31 3.9 AY048121-1|AAK85703.1| 659|Homo sapiens RAS guanyl releasing pr... 30 9.0 AY048119-1|AAK85701.1| 673|Homo sapiens RAS guanyl releasing pr... 30 9.0 >BC068505-1|AAH68505.1| 644|Homo sapiens zinc finger protein 746 protein. Length = 644 Score = 31.5 bits (68), Expect = 3.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 295 PNGNGYEPIDNGAYYVDPPQG-RPYFKPTPFPGARGG 402 P G Y DNG +DP Q RP+ +P +PG G Sbjct: 397 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKG 433 >AK128244-1|BAC87351.1| 459|Homo sapiens protein ( Homo sapiens cDNA FLJ46378 fis, clone TESTI4052775. ). Length = 459 Score = 31.5 bits (68), Expect = 3.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 295 PNGNGYEPIDNGAYYVDPPQG-RPYFKPTPFPGARGG 402 P G Y DNG +DP Q RP+ +P +PG G Sbjct: 212 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKG 248 >AK055975-1|BAB71061.1| 242|Homo sapiens protein ( Homo sapiens cDNA FLJ31413 fis, clone NT2NE2000259, moderately similar to OOCYTE ZINC FINGER PROTEIN XLCOF6.1. ). Length = 242 Score = 31.5 bits (68), Expect = 3.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 295 PNGNGYEPIDNGAYYVDPPQG-RPYFKPTPFPGARGG 402 P G Y DNG +DP Q RP+ +P +PG G Sbjct: 43 PEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKG 79 >AY048121-1|AAK85703.1| 659|Homo sapiens RAS guanyl releasing protein 4 variant 2 protein. Length = 659 Score = 30.3 bits (65), Expect = 9.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 314 NLSTTVHITWTLPKADLTSSLPLSLVLAVGSKEYLRKLI 430 N+ +H +W LP ADL + L S A G + LR+L+ Sbjct: 83 NMVLAMH-SWVLPSADLAARLLTSYQKATGDTQELRRLL 120 >AY048119-1|AAK85701.1| 673|Homo sapiens RAS guanyl releasing protein 4 protein. Length = 673 Score = 30.3 bits (65), Expect = 9.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 314 NLSTTVHITWTLPKADLTSSLPLSLVLAVGSKEYLRKLI 430 N+ +H +W LP ADL + L S A G + LR+L+ Sbjct: 83 NMVLAMH-SWVLPSADLAARLLTSYQKATGDTQELRRLL 120 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,487,685 Number of Sequences: 237096 Number of extensions: 2276703 Number of successful extensions: 10776 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10773 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10538170902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -