BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I19 (838 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025727-10|AAK66029.1| 707|Caenorhabditis elegans Hypothetical... 29 4.1 Z49938-4|CAA90189.3| 2180|Caenorhabditis elegans Hypothetical pr... 28 7.2 Z46811-1|CAA86842.3| 2180|Caenorhabditis elegans Hypothetical pr... 28 7.2 AF316539-1|AAK01632.1| 2200|Caenorhabditis elegans PTP-3A protein. 28 7.2 >AC025727-10|AAK66029.1| 707|Caenorhabditis elegans Hypothetical protein Y73E7A.8 protein. Length = 707 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 257 PPXTSLILPKTTTLMETATNLSTTVHITWTLPKADLTSSLP 379 PP T+ L TTT +T T +TT T T P+ T++ P Sbjct: 355 PPTTTTTLQTTTTRPQT-TKTTTTPQTTTTRPQTTKTTTTP 394 >Z49938-4|CAA90189.3| 2180|Caenorhabditis elegans Hypothetical protein C09D8.1a protein. Length = 2180 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 238 PFPTVGWAKNGFGVIDHN*VSV 173 P P+V W NG + DHN +S+ Sbjct: 75 PLPSVIWRVNGKSITDHNRISI 96 >Z46811-1|CAA86842.3| 2180|Caenorhabditis elegans Hypothetical protein C09D8.1a protein. Length = 2180 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 238 PFPTVGWAKNGFGVIDHN*VSV 173 P P+V W NG + DHN +S+ Sbjct: 75 PLPSVIWRVNGKSITDHNRISI 96 >AF316539-1|AAK01632.1| 2200|Caenorhabditis elegans PTP-3A protein. Length = 2200 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 238 PFPTVGWAKNGFGVIDHN*VSV 173 P P+V W NG + DHN +S+ Sbjct: 75 PLPSVIWRVNGKSITDHNRISI 96 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,534,649 Number of Sequences: 27780 Number of extensions: 328877 Number of successful extensions: 697 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2066533546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -