BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I18 (867 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein... 50 2e-06 At1g49330.1 68414.m05529 hydroxyproline-rich glycoprotein family... 29 3.0 At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein... 28 7.0 >At5g49400.1 68418.m06113 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 275 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +3 Query: 219 RCQKCLEFGHWSYECKGKRKILVRPSRT-RIMHKNLKAKEEGQCSNGS 359 +CQKC + GHW+YECK +R + RPSRT ++ + L+ K +GS Sbjct: 99 QCQKCFQAGHWTYECKNERVYISRPSRTQQLKNPKLRTKPSVDDLDGS 146 >At1g49330.1 68414.m05529 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 331 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 646 WYNSYFQQTXTSPTLYFSYFPTKLILP 726 W ++YFQQT P L +FP + P Sbjct: 107 WMSNYFQQTPNPPQLVTHFFPPSGLAP 133 >At3g42860.1 68416.m04491 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 372 Score = 28.3 bits (60), Expect = 7.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 222 CQKCLEFGHWSYECKGK 272 C KC + GHWS +C G+ Sbjct: 306 CYKCGKQGHWSRDCTGQ 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,424,652 Number of Sequences: 28952 Number of extensions: 238078 Number of successful extensions: 596 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2028915200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -