BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I17 (913 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical... 103 2e-22 U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical pr... 29 4.6 >AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical protein Y105E8A.16 protein. Length = 117 Score = 103 bits (246), Expect = 2e-22 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +2 Query: 209 HRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSK 382 HRIR+TLTS+NV+ LEKVCA LI+GAK + L VKGP+RMPTK+LRITTRKTPCGEGSK Sbjct: 17 HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMPTKVLRITTRKTPCGEGSK 74 Score = 70.1 bits (164), Expect = 2e-12 Identities = 30/41 (73%), Positives = 39/41 (95%) Frame = +1 Query: 391 DRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVXVEVTIAD 513 DRFQMRIHKR+I+LH+P+E+++QITSI+IEPGV +EVT AD Sbjct: 77 DRFQMRIHKRLINLHAPAEVLRQITSISIEPGVDIEVTRAD 117 >U67947-1|AAB07557.2| 1147|Caenorhabditis elegans Hypothetical protein H03E18.1 protein. Length = 1147 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 251 LEKVCADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGE 373 +E V A + G KK+ + K + PTK +T++ P E Sbjct: 359 VELVTAKTVEGEKKETKKPKSTTKKPTKTAAASTKRPPTTE 399 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,498,962 Number of Sequences: 27780 Number of extensions: 265555 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2328783996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -