BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I16 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 0.017 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 0.037 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 29 0.040 04_03_1022 - 21778315-21779007 29 0.041 07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870... 28 0.066 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 28 0.069 08_01_0493 - 4297761-4298288 28 0.072 11_06_0610 - 25449085-25453284 35 0.074 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 32 0.083 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 29 0.11 05_07_0031 - 27183252-27183317,27183542-27184282 31 0.12 07_03_1381 - 26166673-26166747,26166972-26167544 29 0.12 06_01_0835 - 6315762-6316844 28 0.15 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 34 0.17 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 33 0.23 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.23 07_01_0516 - 3850252-3852870 26 0.24 12_02_0859 - 23751198-23753258 26 0.24 02_02_0489 + 10869482-10871218 26 0.25 03_04_0042 - 16743440-16743454,16743907-16744002,16744257-167444... 26 0.26 02_05_0002 - 24849189-24849825,24850267-24850328 26 0.26 08_02_0796 - 21300251-21300373,21300846-21301721 33 0.30 08_01_0060 - 413088-413999 33 0.30 04_01_0197 + 2323790-2324098,2324145-2324774 33 0.30 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 0.32 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 31 0.33 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 26 0.33 03_01_0515 - 3864796-3865425 26 0.34 09_02_0327 - 7284829-7284889,7284946-7286126 33 0.40 10_01_0086 - 1064650-1065379,1065796-1065950,1066029-1066141,106... 29 0.41 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 32 0.52 12_02_0299 - 17051570-17052474,17053542-17053755 32 0.69 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 26 0.69 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 28 0.72 12_01_1043 + 10731454-10732131 26 0.75 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 28 0.83 02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213,146... 26 0.89 06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 26 0.90 03_06_0345 - 33281126-33281783,33281872-33282063,33282175-332822... 27 0.90 07_01_0080 + 587674-588510 31 0.92 02_05_0543 + 29872168-29872767,29873089-29873115 31 0.92 02_05_0239 + 27101440-27101904 26 1.0 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 31 1.1 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 31 1.2 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 26 1.2 12_02_1174 - 26696869-26698191 31 1.2 12_01_0495 - 3935395-3937110 31 1.2 12_01_0373 + 2897874-2898911 31 1.2 11_06_0016 - 19284810-19284926,19285527-19286879 31 1.2 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 31 1.2 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 31 1.2 10_02_0009 + 4128909-4130123 31 1.2 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 31 1.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.2 08_02_0839 + 21693348-21694853 31 1.2 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.2 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 31 1.2 07_03_1771 - 29404972-29405175,29405282-29405677 31 1.2 07_03_0154 + 14509979-14512033 31 1.2 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 31 1.2 06_03_0696 + 23617687-23617851,23618838-23619536 31 1.2 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 31 1.2 05_01_0380 + 2978256-2979284 31 1.2 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.2 04_04_0708 - 27441373-27442611 31 1.2 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 31 1.2 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 31 1.2 02_03_0279 + 17250347-17252098 31 1.2 02_01_0688 + 5131555-5132334 31 1.2 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.2 01_06_1321 + 36280691-36281269 31 1.2 01_06_0969 - 33472588-33474480,33475543-33475623,33475692-334757... 31 1.2 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 31 1.2 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 31 1.2 01_05_0490 + 22672241-22674679 31 1.2 12_02_1070 - 25814741-25815850 29 1.2 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 26 1.4 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 26 1.4 01_01_1127 + 8930593-8932681,8932812-8933401 26 1.5 04_03_0670 - 18544745-18545119,18545319-18545551,18546377-185464... 26 1.6 09_04_0614 - 18962141-18962716,18962839-18963119,18964092-18964293 26 1.6 02_01_0363 - 2612873-2613814 26 1.6 02_01_0358 - 2575858-2576796 26 1.6 01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 29 1.6 03_06_0600 + 34988743-34989407,34990033-34990051 26 1.7 06_03_0743 + 24069752-24070483,24071890-24072345 29 2.0 09_04_0736 - 19815427-19815642,19815782-19816903,19817006-198177... 30 2.1 09_04_0112 - 14757947-14758972 30 2.1 05_01_0210 + 1583176-1584177 30 2.1 04_01_0354 - 4646826-4647314 30 2.1 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 30 2.1 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 26 2.4 10_08_0520 - 18495118-18498237 26 2.5 02_05_0686 - 30900748-30902167,30903442-30904742 25 2.5 04_04_1548 - 34313212-34313304,34313518-34313632,34314097-343142... 26 2.5 07_01_1207 + 11511754-11513865 26 2.5 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 26 2.6 01_06_0264 + 28005997-28006823,28007107-28007290,28007603-28007701 26 2.7 02_05_1277 - 35408097-35409080 26 2.7 06_03_0775 - 24510624-24510655,24511228-24512179 25 2.7 11_01_0687 - 5651002-5651453,5651535-5651951,5652621-5653338,565... 30 2.8 10_08_0095 + 14760292-14760624,14760689-14761000,14761768-147624... 30 2.8 06_03_1153 - 28047125-28047751 30 2.8 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 30 2.8 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 26 3.2 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 24 3.2 07_03_0890 - 22332768-22333382 29 3.7 09_04_0382 + 17135554-17136468,17136762-17136833,17137675-171377... 29 3.7 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 3.7 05_04_0011 + 17139322-17139451,17139552-17140174 29 3.7 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 3.7 04_04_0951 + 29614196-29615275 26 4.5 03_02_0342 - 7645323-7645909,7646323-7646491 29 4.7 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 4.9 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 4.9 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 29 4.9 12_01_0319 + 2440129-2440661,2440875-2440902 29 4.9 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 29 4.9 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 29 4.9 11_02_0005 - 7264736-7264753,7265086-7265188,7265487-7265539,726... 29 4.9 10_08_0534 + 18595520-18595828,18595917-18597149 29 4.9 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 29 4.9 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 29 4.9 09_04_0365 - 16962608-16963174,16963301-16963486,16963824-169638... 29 4.9 09_02_0181 - 5425833-5426527,5426667-5429397 29 4.9 09_01_0016 - 376742-376883,377973-378964 29 4.9 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 4.9 07_01_0862 - 7172083-7172931 29 4.9 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 29 4.9 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.9 07_01_0015 + 108338-109186 29 4.9 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 29 4.9 06_01_0561 - 3983308-3983564,3983652-3983775 29 4.9 06_01_0420 + 2998269-2999195 29 4.9 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 29 4.9 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 4.9 05_02_0124 + 6849034-6851502 29 4.9 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 29 4.9 05_01_0192 + 1394342-1396645 29 4.9 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 4.9 04_04_0887 + 29095087-29096166 29 4.9 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 4.9 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 4.9 04_03_0314 - 14238620-14240128 29 4.9 04_03_0057 + 10407402-10407452,10407540-10407782,10408506-104089... 29 4.9 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 4.9 03_06_0411 + 33741903-33742163,33742990-33743168,33743342-337434... 29 4.9 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 29 4.9 02_05_0925 - 32768815-32769654 29 4.9 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 29 4.9 02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570,273... 29 4.9 01_06_1596 - 38514278-38514346,38514547-38514705,38514776-385148... 29 4.9 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 29 4.9 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 29 4.9 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.9 01_01_0796 + 6190931-6192745 29 4.9 01_01_0046 - 331758-332627 29 4.9 08_02_0057 - 11766826-11767224 26 5.0 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 25 5.4 10_08_1026 + 22400551-22401161,22401437-22401632,22401837-224018... 25 5.7 02_05_0789 + 31766300-31767056,31767316-31767659 25 5.8 10_08_0922 - 21593030-21593225,21593319-21594142 24 5.9 01_01_0369 - 2886060-2886272,2886721-2887434 25 5.9 03_03_0038 + 13984525-13984917,13985351-13985429,13985535-139856... 24 6.1 09_03_0145 - 12749288-12751510 29 6.5 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 29 6.5 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 25 7.1 03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572... 24 7.1 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 28 7.1 01_06_0650 + 30872350-30872736,30873388-30873639,30873723-308738... 25 7.3 02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482,441... 26 7.5 04_04_1542 - 34264994-34265331,34266195-34267029 26 7.5 01_02_0031 + 10364487-10365407 25 7.7 07_03_1382 - 26170563-26170631,26171151-26171843 26 7.8 11_05_0093 + 18992027-18993514 28 8.5 10_08_0738 - 20212220-20212282,20212387-20212593,20212690-202128... 28 8.5 10_08_0026 - 14253680-14253894,14253981-14254109,14254704-142547... 28 8.5 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 28 8.5 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 28 8.5 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 28 8.5 06_01_0178 + 1386981-1387505 28 8.5 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 28 8.5 04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670,322... 28 8.5 03_06_0599 + 34984869-34985319,34986581-34987563 28 8.5 03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539,117... 28 8.5 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 28 8.5 01_06_1424 - 37269397-37270299 28 8.5 01_06_0922 - 33022709-33023545 28 8.5 01_05_0423 + 22032940-22033695 28 8.5 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 28 8.5 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 23 9.0 02_02_0240 + 8196140-8198248,8198381-8198650 25 9.1 01_06_1365 - 36690267-36692222 25 9.3 11_06_0326 - 22382001-22383248 23 9.7 05_06_0227 + 26565169-26566380 23 9.7 01_02_0048 - 10626467-10627498,10628522-10628617 23 9.8 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N PPPPPPP PP Sbjct: 624 PPPLPNHSVLPPPPPPPPPP 643 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPP PP Sbjct: 557 NKPAFSPPPPPPPPP 571 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 544 PPPPPPPPPP 553 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 545 PPPPPPPPPP 554 Score = 29.1 bits (62), Expect(2) = 0.063 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPPPPP P Sbjct: 561 FSPPPPPPPPPPPPLP 576 Score = 29.1 bits (62), Expect(2) = 0.037 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 563 PPPPPPPPPP 572 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 564 PPPPPPPPPP 573 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 565 PPPPPPPPPP 574 Score = 29.1 bits (62), Expect(2) = 0.017 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 690 PPPPPPPLPP 699 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 535 PSPSPTAAAPPPPPPPPPP 553 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + N PPPPPPP P Sbjct: 609 PPILPNRSVPPPPPPPPPLP 628 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 709 PSAPPPPPPPPP 720 Score = 27.1 bits (57), Expect(2) = 0.017 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + P PPPPPPP Sbjct: 656 PGIGNKFPAPPPPPPPP 672 Score = 25.8 bits (54), Expect(2) = 0.037 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 545 PPPPPPPPPP 554 Score = 25.0 bits (52), Expect(2) = 0.063 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 604 PPPPPPPILP 613 >04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 Length = 1064 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 160 PPPPPPPPPP 169 Score = 29.1 bits (62), Expect(2) = 0.037 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 161 PPPPPPPPPP 170 Score = 25.8 bits (54), Expect(2) = 0.037 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 160 PPPPPPPPPP 169 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 39 PPPPPPPPPP 48 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 40 PPPPPPPPPP 49 Score = 29.1 bits (62), Expect(2) = 0.040 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 41 PPPPPPPPPP 50 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 39 PPPPPPPPPPPP 50 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 41 PPPPPPPPPPAP 52 Score = 25.8 bits (54), Expect(2) = 0.040 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 7 PAKPPPPPPP 16 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 36 PPPPPPPPPP 45 Score = 29.1 bits (62), Expect(2) = 0.041 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 37 PPPPPPPPPP 46 Score = 25.8 bits (54), Expect(2) = 0.041 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 36 PPPPPPPPPP 45 >07_01_1123 - 10385215-10385574,10385676-10385810,10386385-10387091, 10387158-10387455 Length = 499 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 6 PPIPPPPPPPPP 17 Score = 27.9 bits (59), Expect(2) = 0.066 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N P PPPPPPP Sbjct: 5 NPPIPPPPPPPP 16 Score = 26.2 bits (55), Expect(2) = 0.066 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 9 PPPPPPPPP 17 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 28.3 bits (60), Expect(2) = 0.069 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 53 PHPPPPPPPPQP 64 Score = 25.8 bits (54), Expect(2) = 0.069 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 85 PPPPPPQKPP 94 >08_01_0493 - 4297761-4298288 Length = 175 Score = 28.3 bits (60), Expect(2) = 0.072 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 112 PAVPPPPPPPPP 123 Score = 25.8 bits (54), Expect(2) = 0.072 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 116 PPPPPPPPSP 125 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 35.1 bits (77), Expect = 0.074 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = -2 Query: 392 LVLSPAGPKTLVP*A*PVSLPRSSLKIXLL*PAFPKSPSSFCPKVPKTLPPPICLS 225 ++LSP K+L P A PVSLP +K P P +P S P V K+LPPP +S Sbjct: 1254 VILSPPAVKSLPPPA-PVSLPPPPVKSL---P--PPAPVSLPPPVVKSLPPPAPVS 1303 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 815 PXLFXNX-PXXPPPPPPPXPP 874 P F N P PPPPPPP PP Sbjct: 338 PSRFNNTTPKPPPPPPPPEPP 358 Score = 27.9 bits (59), Expect(2) = 0.083 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N P PPPPPPP Sbjct: 326 NPPPAPPPPPPP 337 Score = 25.8 bits (54), Expect(2) = 0.083 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 329 PAPPPPPPPP 338 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 160 PPPPPPPMPP 169 Score = 24.2 bits (50), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 155 PPLPLPPPPPPP 166 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 115 PSPPPPPPPPPPP 127 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 119 PPPPPPPPPP 128 Score = 28.3 bits (60), Expect(2) = 0.12 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 117 PPPPPPPPPPPP 128 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 T TT P + P PPPPP PP Sbjct: 129 TTTTKPESLPAEADSEPELKAPPPPPPPP 157 Score = 25.8 bits (54), Expect(2) = 0.74 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 119 PPPPPPPPPP 128 Score = 25.0 bits (52), Expect(2) = 0.12 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 152 PPPPPPPLLP 161 Score = 24.6 bits (51), Expect(2) = 0.74 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P+ PPPP PPP Sbjct: 113 PQPSPPPPPPPPPPP 127 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.1 bits (62), Expect(2) = 0.12 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 161 PPPPPPPPPP 170 Score = 24.2 bits (50), Expect(2) = 0.12 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 158 NENPPPPPPPPP 169 >06_01_0835 - 6315762-6316844 Length = 360 Score = 27.9 bits (59), Expect(2) = 0.15 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPP 865 T TTS + P PPPPPPP Sbjct: 295 TTTTSEGDESAISACSPPLPPPPPPP 320 Score = 25.8 bits (54), Expect(2) = 4.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 312 PLPPPPPPPP 321 Score = 25.0 bits (52), Expect(2) = 0.15 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 312 PLPPPPPPPP 321 Score = 21.8 bits (44), Expect(2) = 4.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 316 PPPPPPAALP 325 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 797 TSXXYXPXLFXNXPXXPPPPPPPXPP 874 TS P N P PPPPPPP PP Sbjct: 336 TSPSPRPVQPSNAPPPPPPPPPPPPP 361 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 350 PPPPPPPPPPPPP 362 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 351 PPPPPPPPPPPPP 363 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 352 PPPPPPPPPPPPP 364 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 353 PPPPPPPPPPPPP 365 Score = 27.1 bits (57), Expect(2) = 0.18 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N PPPPPPP P Sbjct: 368 NTAPKPPPPPPPPP 381 Score = 25.4 bits (53), Expect(2) = 0.18 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 375 PPPPPPPSVP 384 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 349 PPPPPPPPPPPPPPPPP 365 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 375 PPPPPPPSVP 384 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P F P PPPPPPP PP Sbjct: 32 PFTFLCPPPPPPPPPPPPPP 51 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 40 PPPPPPPPPPPPP 52 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 41 PPPPPPPPPPPPP 53 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 42 PPPPPPPPPPPPP 54 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 43 PPPPPPPPPPPPP 55 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 44 PPPPPPPPPPPPP 56 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPP 368 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 357 PPPPPPPPPPPPP 369 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 358 PPPPPPPPPPPPP 370 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 359 PPPPPPPPPPPPP 371 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 362 PPPPPPPPPPRPP 374 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T PK PPPP PPP P Sbjct: 345 TSDAPKLMPPPPPPPPPPPPP 365 >07_01_0516 - 3850252-3852870 Length = 872 Score = 26.2 bits (55), Expect(2) = 0.24 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 27 PPPPPPPPP 35 Score = 25.8 bits (54), Expect(2) = 0.24 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 25 PLPPPPPPPP 34 >12_02_0859 - 23751198-23753258 Length = 686 Score = 26.2 bits (55), Expect(2) = 0.24 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 626 PPPPPPPPP 634 Score = 25.8 bits (54), Expect(2) = 0.24 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 624 PEPPPPPPPP 633 >02_02_0489 + 10869482-10871218 Length = 578 Score = 26.2 bits (55), Expect(2) = 0.25 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 10 PPPPPPPPP 18 Score = 25.8 bits (54), Expect(2) = 0.25 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 8 PTPPPPPPPP 17 >03_04_0042 - 16743440-16743454,16743907-16744002,16744257-16744475, 16744830-16744910,16745092-16745187,16745981-16746045, 16746131-16746217,16746522-16746720 Length = 285 Score = 26.2 bits (55), Expect(2) = 0.26 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 17 PPPPPPPPP 25 Score = 25.8 bits (54), Expect(2) = 0.26 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 15 PRPPPPPPPP 24 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 26.2 bits (55), Expect(2) = 0.26 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 218 PPPPPPPPP 226 Score = 25.8 bits (54), Expect(2) = 0.26 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 216 PHPPPPPPPP 225 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 97 PPLLALPPPPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 95 PSPPLLALPPPPPPPPPPP 113 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 107 PPPPPPPPPPQP 118 >08_01_0060 - 413088-413999 Length = 303 Score = 33.1 bits (72), Expect = 0.30 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P LF P PPPPPPP P Sbjct: 21 HHPLLFDQPPPPPPPPPPPPLP 42 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 33.1 bits (72), Expect = 0.30 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPPP PP Sbjct: 26 NPPPPPPPPPPPPPP 40 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 29 PPPPPPPPPPPPP 41 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 22 NHQGNPPPPPPPPPP 36 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 54 PPPPPPPGPP 63 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 108 PPPPPPPSPP 117 Score = 25.8 bits (54), Expect(2) = 0.32 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 118 PSAPPPPPPP 127 Score = 25.8 bits (54), Expect(2) = 0.32 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 122 PPPPPPPTQP 131 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 24 PVPPPPPPPPPPP 36 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 28 PPPPPPPPPP 37 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 26 PPPPPPPPPPPP 37 Score = 25.8 bits (54), Expect(2) = 0.33 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 20 PAPAPVPPPPPPPPPPP 36 Score = 25.8 bits (54), Expect(2) = 0.33 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 28 PPPPPPPPPP 37 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 25.8 bits (54), Expect(2) = 0.33 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 32 PSDPPPPPPP 41 Score = 25.8 bits (54), Expect(2) = 0.33 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 63 PQPPPPPLPP 72 >03_01_0515 - 3864796-3865425 Length = 209 Score = 25.8 bits (54), Expect(2) = 0.34 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 68 PLMPPPPPPP 77 Score = 25.8 bits (54), Expect(2) = 0.34 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 99 PPPPPPSPPP 108 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXPP 874 +F P PPPPPPP PP Sbjct: 48 IFGAHPPPPPPPPPPPPP 65 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 54 PPPPPPPPPPPPP 66 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 55 PPPPPPPPPPPPP 67 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 770 SPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 SP + + Y + PPPPPPP PP Sbjct: 30 SPPLSPCPSPASSYKERIIFGAHPPPPPPPPPPPP 64 >10_01_0086 - 1064650-1065379,1065796-1065950,1066029-1066141, 1066238-1066345,1066773-1066890,1066996-1067069, 1067595-1067690,1068062-1068455 Length = 595 Score = 29.1 bits (62), Expect(2) = 0.41 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 107 PPPPPPPRPP 116 Score = 22.2 bits (45), Expect(2) = 0.41 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPP P Sbjct: 106 PPPPPPPPRP 115 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 299 PELSKLPPIPPPPPPPPPPP 318 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 240 PPPPPPPLPP 249 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 309 PPPPPPPPPPMP 320 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P L P PPPPPPP PP Sbjct: 309 HFPPLPSFYPSPPPPPPPPPPP 330 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 316 FYPSPPPPPPPPPPPPP 332 Score = 31.5 bits (68), Expect = 0.92 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + + P PPPPPPP P Sbjct: 314 PSFYPSPPPPPPPPPPPPP 332 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 312 PLPSFYPSPPPPPPPPPPP 330 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 290 PPPPPPPPP 298 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 290 PPPPPPPPP 298 Score = 24.2 bits (50), Expect(2) = 0.69 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPP 865 T TT P L P PPPPP P Sbjct: 255 TVTTPRNRKPEL-SKLPPIPPPPPMP 279 Score = 22.2 bits (45), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 P PPPPP P Sbjct: 271 PIPPPPPMP 279 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 28.3 bits (60), Expect(2) = 0.72 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 51 PHQPPPPPPPPP 62 Score = 26.2 bits (55), Expect(2) = 7.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 56 PPPPPPPLP 64 Score = 22.2 bits (45), Expect(2) = 0.72 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 82 PPPPPPMGAP 91 Score = 20.6 bits (41), Expect(2) = 7.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 854 PPPPXPP 874 PPPP PP Sbjct: 81 PPPPPPP 87 >12_01_1043 + 10731454-10732131 Length = 225 Score = 25.8 bits (54), Expect(2) = 0.75 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 49 PPPPPPPPAP 58 Score = 24.6 bits (51), Expect(2) = 0.75 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 45 PASVPPPPPPPP 56 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 89 PTPPPPPPPPLP 100 Score = 25.0 bits (52), Expect(2) = 0.83 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 87 PAPTPPPPPPPP 98 Score = 25.0 bits (52), Expect(2) = 0.83 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 91 PPPPPPPPLP 100 >02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213, 1464101-1464207,1464289-1464375,1465332-1465414, 1465959-1466027,1466332-1466658,1466744-1466957, 1467170-1467267,1467516-1467554,1467672-1468160 Length = 722 Score = 25.8 bits (54), Expect(2) = 0.89 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 32 PTPPPPPPPP 41 Score = 24.2 bits (50), Expect(2) = 0.89 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 29 NPNPTPPPPPPP 40 >06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 Length = 700 Score = 25.8 bits (54), Expect(2) = 0.90 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 241 PPPPPPPPTP 250 Score = 24.2 bits (50), Expect(2) = 0.90 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 237 PEFLPPPPPPPP 248 >03_06_0345 - 33281126-33281783,33281872-33282063,33282175-33282217, 33282751-33282874,33282966-33283058,33284484-33284685, 33284751-33284857,33285462-33285543,33285629-33285666, 33285751-33285837,33286324-33286434,33286554-33286904 Length = 695 Score = 26.6 bits (56), Expect(2) = 0.90 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + P PPPPPPP Sbjct: 42 PRACNSRPKVPPPPPPP 58 Score = 23.4 bits (48), Expect(2) = 0.90 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 52 PPPPPPPP 59 >07_01_0080 + 587674-588510 Length = 278 Score = 31.5 bits (68), Expect = 0.92 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 98 PPSSGSPPPPPPPPPPPPPP 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 106 PPPPPPPPPPPPP 118 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 107 PPPPPPPPPPPPP 119 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 108 PPPPPPPPPPPPP 120 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 109 PPPPPPPPPPPPP 121 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 31.5 bits (68), Expect = 0.92 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXPP 874 ++ P PPPPPPP PP Sbjct: 174 IWGESPAAPPPPPPPPPP 191 >02_05_0239 + 27101440-27101904 Length = 154 Score = 25.8 bits (54), Expect(2) = 1.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 41 PDPPPPPTPP 50 Score = 24.2 bits (50), Expect(2) = 1.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 LF PPP PPP P Sbjct: 31 LFQAVARGPPPDPPPPP 47 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 12 PAPPPPPPPPPPP 24 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 14 PPPPPPPPPPPPP 26 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 15 PPPPPPPPPPPPP 27 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 18 PPPPPPPPPP 27 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 12 PAPPPPPPPPPPPPP 26 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 425 PYAPPPPPPPPPP 437 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 429 PPPPPPPPPP 438 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 430 PPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 428 PPPPPPPPPPPP 439 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 430 PPPPPPPPPP 439 Score = 23.8 bits (49), Expect(2) = 1.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 424 PPYAPPPPPPPPPPP 438 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 221 PPPPPPPPSP 230 Score = 23.8 bits (49), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P K PPPP PPP Sbjct: 211 PKLKGPKGAPPPPPPPP 227 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 150 PSLPPPPPPPPPP 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 153 PPPPPPPPPPPPP 165 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 156 PPPPPPPPPPRPP 168 >12_01_0495 - 3935395-3937110 Length = 571 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 7 PPLPPPPPPPPPP 19 >12_01_0373 + 2897874-2898911 Length = 345 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 152 PRRPPPPPPPPPP 164 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 84 PPSPPPPPPPPPP 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 85 PSPPPPPPPPPPP 97 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 88 PPPPPPPPPPRP 99 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 320 PPPPPPPPPPVPP 332 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 315 NANMFPPPPPPPPPP 329 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N P PPPPPPP P Sbjct: 337 NPPPPPPPPPPPPP 350 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 333 NHQGNPPPPPPPPPP 347 >10_02_0009 + 4128909-4130123 Length = 404 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 81 PPSPPPPPPPPPP 93 Score = 24.6 bits (51), Expect(2) = 5.8 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPP 870 T P PPPP PPP Sbjct: 75 TSTSPSPPSPPPPPPPPPP 93 Score = 22.6 bits (46), Expect(2) = 5.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 87 PPPPPPPQQP 96 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 79 PPSPPPPPPPPPP 91 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 80 PSPPPPPPPPPPP 92 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 82 PPPPPPPPPPPPP 94 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 83 PPPPPPPPPPPPP 95 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 794 TTSXXYXPXLFXNXPXXPPPPPPPXP 871 TTS P PPPPPPP P Sbjct: 102 TTSWTTNSSSISASPILPPPPPPPMP 127 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P+ PPPP PPP P Sbjct: 74 PPPQTPPSPPPPPPPPPPP 92 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 264 PPPPPPPPPPPPP 276 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 267 PPPPPPPPPPMPP 279 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPPP P Sbjct: 50 NAPALPPPPPPPPAP 64 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P+ PPPP PPP P Sbjct: 257 PPPQSVRPPPPPPPPPPPP 275 Score = 25.8 bits (54), Expect(2) = 4.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 55 PPPPPPPPAP 64 Score = 21.8 bits (44), Expect(2) = 4.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 823 FPKXXXXXPPPPXPPP 870 FP PPP PPP Sbjct: 46 FPLENAPALPPPPPPP 61 >08_02_0839 + 21693348-21694853 Length = 501 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 26 PYLPPPPPPPQPP 38 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 428 PPLPPPPPPPPPP 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 429 PLPPPPPPPPPPP 441 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 431 PPPPPPPPPPPPP 443 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 434 PPPPPPPPPPLPP 446 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 19 PPPPPPPPPPLPP 31 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 18 PPPPPPPPPP 27 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 16 PPPPPPPPPPLPP 28 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 14 PLPPPPPPPPPP 25 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PPPPPPPPPPPPP 65 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 54 PPPPPPPPPPPPP 66 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 47 PLPAAAPPPPPPPPPPPPP 65 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 45 PLPLPAAAPPPPPPPPPPP 63 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 249 PLPPPPPPPPGPP 261 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 771 PPXXX*PLQLPLXTXXPFSXIXPXXPPPPXPPXXP 875 PP PL P + P PPPP PP P Sbjct: 205 PPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKP 239 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 380 PRFPPPPPPP 389 Score = 25.4 bits (53), Expect(2) = 5.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 253 PPPPPPGPPP 262 Score = 25.0 bits (52), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 204 PPPPPPPPLP 213 Score = 24.6 bits (51), Expect(2) = 7.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P P Sbjct: 251 PPPPPPPPGPPP 262 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 200 PSTLPPPPPPPP 211 Score = 23.4 bits (48), Expect(2) = 9.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 273 PPPPPPRP 280 Score = 23.0 bits (47), Expect(2) = 9.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPP PPP Sbjct: 246 PGLPLPPPPPPPPGPPP 262 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP PP Sbjct: 385 PPPPPDTRPP 394 Score = 22.2 bits (45), Expect(2) = 7.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 274 PPPPPRPLQP 283 Score = 21.8 bits (44), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPP P Sbjct: 204 PPPPPPPPLP 213 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 78 PPPPPPPPPPSPP 90 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 77 PPPPPPPPPP 86 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXPP 874 L P PPPPPPP P Sbjct: 72 LIKQTPPPPPPPPPPPSP 89 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 200 PPLPPPPPPPPPP 212 >05_01_0380 + 2978256-2979284 Length = 342 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 26 PPPPPPPPPPPPP 38 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 27 PPPPPPPPPPPPP 39 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 28 PPPPPPPPPPPPP 40 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 29 PPPPPPPPPPPPP 41 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 32 PPPPPPPPPPRP 43 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 10 PPPPPPPPPPPPP 22 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 11 PPPPPPPPPPPPP 23 >04_04_0708 - 27441373-27442611 Length = 412 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 238 PLLPPPPPPPPPP 250 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 242 PPPPPPPPPP 251 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 365 PPPPPPPPPPPPP 377 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 366 PPPPPPPPPPPPP 378 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 362 NMRPPPPPPPPPPPP 376 Score = 25.8 bits (54), Expect(2) = 7.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 397 PPPPTPPPPP 406 Score = 21.0 bits (42), Expect(2) = 7.0 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 826 PKXXXXXPPPPXPP 867 P PPPP PP Sbjct: 365 PPPPPPPPPPPPPP 378 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 14 PTPPPPPPPPPPP 26 >02_03_0279 + 17250347-17252098 Length = 583 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 124 PPPPPPPPPPPPP 136 >02_01_0688 + 5131555-5132334 Length = 259 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 163 PLMPPPPPPPAPP 175 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 116 PPRPPPPPPPHPP 128 >01_06_1321 + 36280691-36281269 Length = 192 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 144 PPSPPPPPPPPPP 156 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 147 PPPPPPPPPPLPP 159 >01_06_0969 - 33472588-33474480,33475543-33475623,33475692-33475740, 33475866-33476281,33477208-33477447 Length = 892 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 272 PQPPPPPPPPTPP 284 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P +F P PPPPPP P Sbjct: 263 PSVFAPRPKPQPPPPPPPP 281 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 4 PPPPPPPPPPSPP 16 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 2 PPPPPPPPPP 11 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 3 PPPPPPPPPP 12 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 2 PPPPPPPPPPPP 13 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 74 PSPPPPPPPPPPP 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 76 PPPPPPPPPPPPP 88 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 79 PPPPPPPPPPVP 90 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 694 PPLPPPPPPPPPP 706 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 686 TYPLPPPSPPLPPPPPPPPPP 706 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 604 PRRPPPPPPPPP 615 >12_02_1070 - 25814741-25815850 Length = 369 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + + PPPPPPP PP Sbjct: 227 PKIRLSPTQAPPPPPPPPPP 246 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 238 PPPPPPPPPP 247 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 239 PPPPPPPPPP 248 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 237 PPPPPPPPPPPP 248 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 239 PPPPPPPPPP 248 Score = 23.8 bits (49), Expect(2) = 1.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 233 PTQAPPPPPPPPPPP 247 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 125 PPPPPPPSP 133 Score = 23.0 bits (47), Expect(2) = 1.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 123 PPPPPPPPP 131 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 938 PGGPPPPPPP 947 Score = 23.4 bits (48), Expect(2) = 1.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 941 PPPPPPPP 948 >01_01_1127 + 8930593-8932681,8932812-8933401 Length = 892 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 9 PSAPPPPPPP 18 Score = 23.4 bits (48), Expect(2) = 1.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 12 PPPPPPPP 19 >04_03_0670 - 18544745-18545119,18545319-18545551,18546377-18546476, 18546842-18546910,18547822-18547900,18547989-18548224 Length = 363 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 14 PPPPPPPRP 22 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 12 PAPPPPPPP 20 >09_04_0614 - 18962141-18962716,18962839-18963119,18964092-18964293 Length = 352 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 266 PAMPPPPPPP 275 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 269 PPPPPPPP 276 >02_01_0363 - 2612873-2613814 Length = 313 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 111 PPPPPPPSP 119 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 109 PLPPPPPPP 117 >02_01_0358 - 2575858-2576796 Length = 312 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 111 PPPPPPPSP 119 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 109 PLPPPPPPP 117 >01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 Length = 273 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 38 PPPPPPPPPP 47 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 38 PPPPPPPPPPQP 49 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 40 PPPPPPPPQP 49 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 824 FXNXPXXPPPPPP 862 F P PPPPPP Sbjct: 35 FLLPPPPPPPPPP 47 >03_06_0600 + 34988743-34989407,34990033-34990051 Length = 227 Score = 26.2 bits (55), Expect(2) = 1.7 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 154 PPPPPPPGP 162 Score = 23.0 bits (47), Expect(2) = 1.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 152 PPPPPPPPP 160 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 25 PPPPPPPPPP 34 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 25 PPPPPPPPPP 34 Score = 23.0 bits (47), Expect(2) = 2.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPP PP Sbjct: 49 PPPPPSSPP 57 >09_04_0736 - 19815427-19815642,19815782-19816903,19817006-19817707, 19817808-19817855,19817959-19818201,19819035-19819391 Length = 895 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 794 TTSXXYXPXLFXNXPXXPPPPPPPXPP 874 T Y P + N P PPPPPP PP Sbjct: 754 TQHSAYNPEMTLNLP--PPPPPPTLPP 778 >09_04_0112 - 14757947-14758972 Length = 341 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N P PPPPPPP P Sbjct: 290 NPPTSPPPPPPPPP 303 >05_01_0210 + 1583176-1584177 Length = 333 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P F P PPPPPPP P Sbjct: 23 PHHFAPDPLPPPPPPPPPP 41 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 32 PPPPPPPPPP 41 >04_01_0354 - 4646826-4647314 Length = 162 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N PPPPPPP PP Sbjct: 83 PHPLPNLNLSPPPPPPPPPP 102 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 90 NLSPPPPPPPPPPPP 104 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 85 PLPNLNLSPPPPPPPPPPP 103 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L + P PPPPPPP Sbjct: 87 PNLNLSPPPPPPPPPPP 103 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P+ PPPP PPP P Sbjct: 24 TRPPPRTRVRPPPPPAPPPPP 44 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPP PPP PP Sbjct: 47 PPPSPPPPPP 56 Score = 22.6 bits (46), Expect(2) = 2.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P P PPPPP Sbjct: 46 PPPPSPPPPP 55 >10_08_0520 - 18495118-18498237 Length = 1039 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 88 PAAPPPPPPP 97 Score = 22.6 bits (46), Expect(2) = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP PP Sbjct: 93 PPPPPSAQPP 102 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 353 PPPPPPPKGP 362 Score = 23.0 bits (47), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 311 PAPPPPPPP 319 >04_04_1548 - 34313212-34313304,34313518-34313632,34314097-34314287, 34314391-34315379,34315989-34316136,34316349-34316424, 34316946-34317110,34317196-34317286,34318069-34318153, 34318256-34318411,34318479-34318586,34318713-34318811, 34318927-34319036,34319139-34319208 Length = 831 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 12 PQPPPPPAPP 21 Score = 22.6 bits (46), Expect(2) = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPP P Sbjct: 11 PPQPPPPPAP 20 >07_01_1207 + 11511754-11513865 Length = 703 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 11 PRPPPPPPPP 20 Score = 22.6 bits (46), Expect(2) = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 15 PPPPPPAGAP 24 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 37 PSSPPPPPPP 46 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 41 PPPPPPESSP 50 >01_06_0264 + 28005997-28006823,28007107-28007290,28007603-28007701 Length = 369 Score = 26.2 bits (55), Expect(2) = 2.7 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 6 PPPPPPRPP 14 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPP P Sbjct: 4 PLPPPPPPRP 13 >02_05_1277 - 35408097-35409080 Length = 327 Score = 25.8 bits (54), Expect(2) = 2.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 62 PPPPPPAQPP 71 Score = 22.6 bits (46), Expect(2) = 2.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P P PPPPP Sbjct: 57 PSTPAPPPPP 66 >06_03_0775 - 24510624-24510655,24511228-24512179 Length = 327 Score = 25.0 bits (52), Expect(2) = 2.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPP 862 Y L P PPPPPP Sbjct: 171 YEVFLIPGLPEKPPPPPP 188 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 221 PPPPPSPP 228 >11_01_0687 - 5651002-5651453,5651535-5651951,5652621-5653338, 5654106-5654417,5654482-5654814 Length = 743 Score = 29.9 bits (64), Expect = 2.8 Identities = 27/72 (37%), Positives = 30/72 (41%), Gaps = 3/72 (4%) Frame = +1 Query: 196 SRRHPRDVTWDKQMGGGKVFGTLGQNDDGLFGKAGYNRXIFNDDRGKLTG-QAYGTRVLG 372 SR H TW KQ GGK G G G G G R + TG Q YG V Sbjct: 387 SRSHYIVQTWQKQF-GGKGAGGQGGGQPGYEGGTGQQR--YGVGAPPPTGQQGYGGGVPP 443 Query: 373 P--AGDSTNYGG 402 P +G T +GG Sbjct: 444 PTCSGGHTGFGG 455 >10_08_0095 + 14760292-14760624,14760689-14761000,14761768-14762489, 14762905-14763187,14763419-14763650,14763736-14764187 Length = 777 Score = 29.9 bits (64), Expect = 2.8 Identities = 27/72 (37%), Positives = 30/72 (41%), Gaps = 3/72 (4%) Frame = +1 Query: 196 SRRHPRDVTWDKQMGGGKVFGTLGQNDDGLFGKAGYNRXIFNDDRGKLTG-QAYGTRVLG 372 SR H TW KQ GGK G G G G G R + TG Q YG V Sbjct: 387 SRSHYIVQTWQKQF-GGKGAGGQGGGQPGYEGGTGQQR--YGVGAPPPTGQQGYGGGVPP 443 Query: 373 P--AGDSTNYGG 402 P +G T +GG Sbjct: 444 PTCSGGHTGFGG 455 >06_03_1153 - 28047125-28047751 Length = 208 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P +F P PPPPPPP Sbjct: 12 PAIFCPPPLSPPPPPPP 28 >03_02_0865 - 11895257-11895340,11896004-11896069,11896297-11896355, 11896470-11896557,11897158-11897328,11897406-11897564, 11897653-11897835,11897931-11898012,11898753-11898959, 11899099-11899170,11901948-11902055,11902460-11902506 Length = 441 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPPP P Sbjct: 193 PPLPSQVPAPPPPPPPPQP 211 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 25.8 bits (54), Expect(2) = 3.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 90 PPPPSPPPPP 99 Score = 22.2 bits (45), Expect(2) = 3.2 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 823 FPKXXXXXPPPPXPP 867 +P PPPP PP Sbjct: 63 YPMPGSLPPPPPRPP 77 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 24.2 bits (50), Expect(2) = 3.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P P Sbjct: 54 PDSPPPPPLPTP 65 Score = 23.8 bits (49), Expect(2) = 3.2 Identities = 9/12 (75%), Positives = 9/12 (75%), Gaps = 2/12 (16%) Frame = +2 Query: 845 PPPPPP--PXPP 874 PPPPPP P PP Sbjct: 89 PPPPPPLLPTPP 100 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 84 PPPPPPPPPP 93 Score = 25.4 bits (53), Expect(2) = 3.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 808 IXTXPFPKXXXXXPPPPXPPP 870 + + P P PPPP PPP Sbjct: 72 LGSPPPPPAEATPPPPPPPPP 92 Score = 22.6 bits (46), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 104 PPPPPPPTAP 113 >09_04_0382 + 17135554-17136468,17136762-17136833,17137675-17137704, 17138744-17138817,17140022-17140367 Length = 478 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPP PPP PP Sbjct: 165 NPPAAPPPVPPPMPP 179 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 1152 NQMPLPPPPPPPLPP 1166 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N PPPPPPP PP Sbjct: 94 PDPIHNEFQPPPPPPPPSPP 113 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N PPPPPPP PP Sbjct: 162 PDPIHNEFQPPPPPPPPSPP 181 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 56 TGPNPVHNEFQPPPPPPPPSP 76 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 68 PPPPPPPSPP 77 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 92 TGPDPIHNEFQPPPPPPPPSP 112 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 160 TGPDPIHNEFQPPPPPPPPSP 180 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + P PPPPPPP P Sbjct: 415 PPTHTHGPPPPPPPPPPPP 433 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 422 PPPPPPPPPP 431 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 423 PPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 424 PPPPPPPPPP 433 >04_04_0951 + 29614196-29615275 Length = 359 Score = 26.2 bits (55), Expect(2) = 4.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 60 PPPPPPPLP 68 Score = 21.4 bits (43), Expect(2) = 4.5 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = +2 Query: 779 FXMTXTTSXXYXPXLFXNXPXXPPPPPP 862 F + + S L PPPPPP Sbjct: 39 FVLLASVSIHLLLRLLSRSSPPPPPPPP 66 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 173 PPPPPPPRPP 182 Score = 25.0 bits (52), Expect(2) = 4.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPP PP P Sbjct: 169 FMFAPPPPPPPRPPAP 184 Score = 22.6 bits (46), Expect(2) = 4.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PP P PP PP Sbjct: 205 PPAPKPPAPP 214 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 14 PPPPPPPPPP 23 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXPP 874 L P PPPPPP PP Sbjct: 10 LLLRPPPPPPPPPPNSPP 27 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 145 PPPPPPPPPP 154 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 874 GXXGGXGGGGXXGXIXEKGXXVXXGSCXGHXKXGGS 767 G GG GGGG G +G G G + GGS Sbjct: 187 GGGGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGGS 222 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 46 PPPPPPPPPP 55 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 18 PPPPPPPPPP 27 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 16 PGPPPPPPPPPP 27 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 43 PPPPPPPKPP 52 >11_02_0005 - 7264736-7264753,7265086-7265188,7265487-7265539, 7265791-7265880,7266093-7266217,7266528-7266753 Length = 204 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T PK PPPP PPP P Sbjct: 35 TVSAPKPKAKPPPPPSPPPLP 55 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 35 PPPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 33 PSPPPPPPPPPP 44 >10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 Length = 294 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 201 PPPPPPPPPP 210 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 202 PPPPPPPPPP 211 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 6 PPPPPPPPPP 15 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 6 PPPPPPPPPPRP 17 >09_04_0365 - 16962608-16963174,16963301-16963486,16963824-16963896, 16964307-16964497,16964982-16965198,16965394-16965797, 16966593-16966658,16966668-16966721,16966945-16967079, 16967194-16967391,16967734-16967918,16968990-16969527 Length = 937 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 27 PPPPPPPTPP 36 >09_02_0181 - 5425833-5426527,5426667-5429397 Length = 1141 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/72 (26%), Positives = 28/72 (38%), Gaps = 1/72 (1%) Frame = +1 Query: 190 QSSRRHPRDVTWDKQMGGGKVFGTLGQN-DDGLFGKAGYNRXIFNDDRGKLTGQAYGTRV 366 QS RR + W K++GG + +N DDG G + G + T Sbjct: 959 QSRRRAEKAAAWPKRLGGTGPCASRTENADDGAAGGGDGGSTWGGGSGAPMAGSGFPTHG 1018 Query: 367 LGPAGDSTNYGG 402 G G+ + GG Sbjct: 1019 SGRRGERRDGGG 1030 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 60 PPPPPPPPPP 69 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 61 PPPPPPPPPP 70 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 53 TLPPPPPRTLPPPPPPPPPQP 73 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 65 PPPPPPPQPP 74 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 127 PPPPPPPPPP 136 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 Y P L PPP PPP PP Sbjct: 172 YPPPLPPKKKPLPPPSPPPQPP 193 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 125 PAPPPPPPPPPP 136 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 105 PPPPPPPLPP 114 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 43 PPPPPPPPPP 52 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 44 PPPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 45 PPPPPPPPPP 54 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 823 FPKXXXXXPPPPXPPPXP 876 FP PPPP PPP P Sbjct: 36 FPAAAYAPPPPPPPPPPP 53 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 43 PPPPPPPPPPPP 54 >07_01_0015 + 108338-109186 Length = 282 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 105 PPPPPPPPPP 114 >06_03_0526 + 21771519-21771607,21771685-21771810,21771890-21772010, 21772123-21772851,21772954-21773349,21774594-21774665, 21774741-21774803,21775236-21775337 Length = 565 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 310 PPPPPPPPPP 319 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 31 PPPPPPPPPP 40 >06_01_0420 + 2998269-2999195 Length = 308 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 219 PPPPPPPRPP 228 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 28 PPPPPPPLPP 37 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 218 PPPPPPPPPP 227 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 216 PQPPPPPPPPPP 227 >05_02_0124 + 6849034-6851502 Length = 822 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 17 PPPPPPPSPP 26 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 579 PPPPPPPPPP 588 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 580 PPPPPPPPPP 589 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 581 PPPPPPPPPP 590 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 579 PPPPPPPPPPPP 590 >05_01_0192 + 1394342-1396645 Length = 767 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 3 PPPPPPPPPP 12 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 77 PPPPPPPPPP 86 >04_04_0887 + 29095087-29096166 Length = 359 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 132 PPPPPPPPPP 141 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 132 PPPPPPPPPPLP 143 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 549 PPPPPPPPPP 558 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 550 PPPPPPPPPP 559 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 551 PPPPPPPPPP 560 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 549 PPPPPPPPPPPP 560 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 551 PPPPPPPPPPAP 562 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 101 PPPPPPPPPP 110 >04_03_0314 - 14238620-14240128 Length = 502 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 245 PPPPPPPLPP 254 >04_03_0057 + 10407402-10407452,10407540-10407782,10408506-10408976, 10409058-10409483,10409559-10409618,10409694-10409807, 10409888-10409956 Length = 477 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 416 PPPPPPPSPP 425 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 355 PPPPPPPPPP 364 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 356 PPPPPPPPPP 365 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 357 PPPPPPPPPP 366 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 355 PPPPPPPPPPPP 366 >03_06_0411 + 33741903-33742163,33742990-33743168,33743342-33743426, 33743506-33743822,33743983-33744106,33744810-33744902, 33745296-33745364,33745654-33745704,33745705-33745854, 33745904-33746125,33746413-33746568,33746716-33746823, 33746992-33747126,33747209-33747364,33747544-33747664, 33748182-33748267 Length = 770 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 416 PPPPPPPPPP 425 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 328 PPPPPPPLPP 337 >02_05_0925 - 32768815-32769654 Length = 279 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 156 PPPPPPPPPP 165 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 37 PPPPPPPPPP 46 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 38 PPPPPPPPPP 47 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP P Sbjct: 34 FLLPPPPPPPPPPPSQP 50 >02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570, 2730784-2730858,2730980-2731054,2731155-2731202, 2731548-2732357,2732450-2732498,2733157-2733266, 2733381-2733488,2733920-2733980 Length = 582 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 12 PPPPPPPPPP 21 >01_06_1596 - 38514278-38514346,38514547-38514705,38514776-38514898, 38514985-38515047,38515248-38515352,38515487-38515586, 38515716-38515786,38516329-38516385,38516830-38516907, 38516975-38517049,38517180-38517230,38517453-38517466, 38517516-38517616,38517703-38517764,38518346-38518372, 38518901-38519581 Length = 611 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 141 PPPPPPPLPP 150 >01_05_0292 + 20518668-20519090,20519213-20519281,20520204-20520473, 20520734-20521084,20521251-20521528,20522755-20523099, 20523346-20523911,20525155-20525528 Length = 891 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 49 PLPPEDQLPPPPPLPPPPP 67 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 PFP PPPP PPP Sbjct: 197 PFPAPTRRPPPPPPPPP 213 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 126 PPPPPPPPPP 135 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 193 PPPPPPPPPP 202 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 194 PPPPPPPPPP 203 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 194 PPPPPPPPPPQP 205 >01_01_0046 - 331758-332627 Length = 289 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 21 PPPPPPPPPP 30 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 22 PPPPPPPPPP 31 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 23 PPPPPPPPPP 32 Score = 28.7 bits (61), Expect = 6.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 + P PPPPPPP P Sbjct: 17 YWTSPPPPPPPPPPPP 32 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 823 FPKXXXXXPPPPXPPPXP 876 FP PPPP PPP P Sbjct: 15 FPYWTSPPPPPPPPPPPP 32 >08_02_0057 - 11766826-11767224 Length = 132 Score = 25.8 bits (54), Expect(2) = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 114 PASPPPPPPP 123 Score = 21.8 bits (44), Expect(2) = 5.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 118 PPPPPPTALP 127 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 25.0 bits (52), Expect(2) = 5.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P P Sbjct: 36 PSPPPPPPSPVP 47 Score = 22.2 bits (45), Expect(2) = 5.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP P Sbjct: 49 PAPPPPPHRP 58 >10_08_1026 + 22400551-22401161,22401437-22401632,22401837-22401889, 22402369-22402819 Length = 436 Score = 24.6 bits (51), Expect(2) = 5.7 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 767 GSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXP 871 G P +TS P P PPPPP P Sbjct: 101 GEPGVPEPQSTSAADPPTNDDEWGGDPAPPPPPPP 135 Score = 22.6 bits (46), Expect(2) = 5.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 129 PPPPPPPVP 137 >02_05_0789 + 31766300-31767056,31767316-31767659 Length = 366 Score = 24.6 bits (51), Expect(2) = 5.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 821 LFXNXPXXPPPPPPP 865 +F + PPPPPPP Sbjct: 63 MFLSVLSPPPPPPPP 77 Score = 22.6 bits (46), Expect(2) = 5.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 72 PPPPPPALAP 81 >10_08_0922 - 21593030-21593225,21593319-21594142 Length = 339 Score = 23.8 bits (49), Expect(2) = 5.9 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 184 PPPPPPP 190 Score = 23.4 bits (48), Expect(2) = 5.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 231 PPPPPPQP 238 >01_01_0369 - 2886060-2886272,2886721-2887434 Length = 308 Score = 25.0 bits (52), Expect(2) = 5.9 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +1 Query: 772 PLLXXDXYNFXXIXTXPFPKXXXXXPPPPXPPP 870 P L F + P + PPPP PPP Sbjct: 104 PCLAATAGGFPSLVQPPRVQAPYVAPPPPPPPP 136 Score = 22.2 bits (45), Expect(2) = 5.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 131 PPPPPPPGHP 140 >03_03_0038 + 13984525-13984917,13985351-13985429,13985535-13985628, 13985712-13985844 Length = 232 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 38 PPPPPPP 44 Score = 23.4 bits (48), Expect(2) = 6.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 80 PPPPPPPP 87 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P P PPPPP PP Sbjct: 21 FKPKPTNPSPPPPPPPP 37 >02_04_0056 + 19313422-19313967,19314035-19314168,19314263-19314398, 19314870-19314923,19314995-19315135,19315220-19315546, 19315647-19315916,19316080-19316226,19316890-19317045, 19317223-19317290,19318210-19318309,19318696-19318985, 19319074-19319274,19319840-19319902,19320263-19320356, 19320964-19321035,19321979-19322077,19322254-19322376 Length = 1006 Score = 28.7 bits (61), Expect = 6.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 + + P PPPPPPP P Sbjct: 44 ILLDFPHGPPPPPPPSP 60 >06_03_1368 - 29612463-29612638,29613135-29613222,29613334-29613474, 29613561-29613595,29613990-29614054,29614286-29614335, 29614417-29614521,29614608-29614688,29614771-29614852, 29614941-29614995,29615111-29616164,29617202-29617289, 29617379-29617485,29617568-29617686,29617784-29617994 Length = 818 Score = 25.0 bits (52), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 29 PPPPPPLEPP 38 Score = 21.8 bits (44), Expect(2) = 7.1 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPP P Sbjct: 23 PESTPAPPPPPP 34 >03_02_0758 + 10954268-10954841,10955988-10957145,10957176-10957216, 10957412-10957448,10957534-10957954,10958201-10958234 Length = 754 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 869 GGGXGGGGXXXXNXGKG 819 GGG GGGG G+G Sbjct: 614 GGGGGGGGSGARGRGRG 630 Score = 22.6 bits (46), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 875 GXGGGXGGGG 846 G GGG GGGG Sbjct: 611 GKGGGGGGGG 620 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 79 PPSPPPPPPPPP 90 Score = 23.8 bits (49), Expect(2) = 7.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 75 PPPTPPSPPPPPPPP 89 Score = 23.0 bits (47), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 850 PPPXPPPXP 876 PPP PPP P Sbjct: 82 PPPPPPPPP 90 >01_06_0650 + 30872350-30872736,30873388-30873639,30873723-30873818, 30874005-30874173,30874452-30874552,30874910-30875002, 30876018-30876089,30876509-30876628,30876709-30876759, 30877621-30877809,30878099-30878266 Length = 565 Score = 25.0 bits (52), Expect(2) = 7.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P PP Sbjct: 59 PPPPPLPMPP 68 Score = 21.8 bits (44), Expect(2) = 7.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P Sbjct: 54 PSRSAPPPPPLP 65 >02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482, 4413600-4413689,4413760-4413886,4413983-4414038, 4414203-4414379,4414464-4415057 Length = 427 Score = 25.8 bits (54), Expect(2) = 7.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 119 PPPPPPPPLP 128 Score = 21.0 bits (42), Expect(2) = 7.5 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P+ PPP PPP Sbjct: 111 PRGRELLLPPPPPPP 125 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 26.2 bits (55), Expect(2) = 7.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 227 PPPPPPSPP 235 Score = 20.6 bits (41), Expect(2) = 7.5 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 845 PPPPPPP 865 P PPPPP Sbjct: 215 PTPPPPP 221 >01_02_0031 + 10364487-10365407 Length = 306 Score = 25.0 bits (52), Expect(2) = 7.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 176 PALPAPPPPPAP 187 Score = 21.8 bits (44), Expect(2) = 7.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 181 PPPPPAPMLP 190 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 26.2 bits (55), Expect(2) = 7.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 184 PPPPPPPQP 192 Score = 20.6 bits (41), Expect(2) = 7.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 854 PPPPXPP 874 PPPP PP Sbjct: 200 PPPPPPP 206 >11_05_0093 + 18992027-18993514 Length = 495 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 372 PNPPPPPPPPTP 383 >10_08_0738 - 20212220-20212282,20212387-20212593,20212690-20212819, 20212919-20213089,20213311-20213433,20213517-20213618, 20214123-20214880 Length = 517 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 24 PHPPPPPPPPLP 35 >10_08_0026 - 14253680-14253894,14253981-14254109,14254704-14254769, 14254887-14255133 Length = 218 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 162 PGSPPPPPPPSP 173 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 789 PLQLPLXTXXPFSXIXPXXPPPPXPPXXP 875 P P T P + P PPPP PP P Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPLP 1189 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 40 PPSPPPPPPPPP 51 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPP PP Sbjct: 55 FQLPPDAAPPPPPPPPP 71 >06_01_0178 + 1386981-1387505 Length = 174 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 874 GXXGGXGGGGXXGXIXEKGXXVXXGSCXGHXKXGG 770 G GG GGGG G G G GH GG Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGG 71 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 874 GXXGGXGGGGXXGXIXEKGXXVXXGSCXGHXKXGGS 767 G GG GGGG G +G G G GGS Sbjct: 90 GAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGS 125 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 385 STNYGGRLXWANXNAQATXDLNRQI--XGRSXMT 480 S+ +GG L W N + ++T D +RQ+ GR +T Sbjct: 960 SSLHGGSLPWKNTDFESTVDFDRQLPYDGREVVT 993 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 1928 PHAPPPPPPPPP 1939 >04_01_0246 + 3225743-3226473,3226493-3226624,3227580-3227670, 3228617-3229074,3229342-3229864 Length = 644 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 34 PTTPPPPPPPPP 45 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 401 PPQPPPPPPPPP 412 >03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539, 1178179-1178378,1178505-1178605,1178747-1179369, 1179451-1179546,1179637-1179798,1179889-1180068, 1180173-1180323,1180408-1180641,1180753-1180913, 1181041-1181163,1181261-1181421,1181655-1181877, 1181952-1182346,1182461-1182671,1183536-1184522 Length = 1883 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 75 PAPPPPPPPPLP 86 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 24 PPLPPPPPPPPP 35 >01_06_1424 - 37269397-37270299 Length = 300 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 40 PRMPPPPPPPDP 51 >01_06_0922 - 33022709-33023545 Length = 278 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 225 PLEPPPPPPPQP 236 >01_05_0423 + 22032940-22033695 Length = 251 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 25 PPQPPPPPPPPP 36 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 28.3 bits (60), Expect = 8.5 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 6/62 (9%) Frame = -2 Query: 404 RPP*LVLSPAGPKT-LVP*A*PVSLPRSSLKIXLL*PAFP-----KSPSSFCPKVPKTLP 243 +PP +PA P T L P P ++P+ + P P K P SF P++ T+P Sbjct: 217 KPP--AYAPAKPPTALRPAIPPAAMPKPPSVAPVQPPQRPPAPATKPPPSFPPQLAPTMP 274 Query: 242 PP 237 PP Sbjct: 275 PP 276 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 23.4 bits (48), Expect(2) = 9.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 636 PPPPPPRP 643 Score = 23.0 bits (47), Expect(2) = 9.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 633 PGGPPPPPP 641 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 24.6 bits (51), Expect(2) = 9.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 589 PTMHPPPPPPIP 600 Score = 21.8 bits (44), Expect(2) = 9.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 594 PPPPPIPGQP 603 >01_06_1365 - 36690267-36692222 Length = 651 Score = 25.0 bits (52), Expect(2) = 9.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 158 PHQQPPPPPPRP 169 Score = 21.4 bits (43), Expect(2) = 9.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 163 PPPPPRPFIP 172 >11_06_0326 - 22382001-22383248 Length = 415 Score = 23.4 bits (48), Expect(2) = 9.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 266 PPPPPPAP 273 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 263 PRAPPPPPP 271 >05_06_0227 + 26565169-26566380 Length = 403 Score = 23.4 bits (48), Expect(2) = 9.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 47 PPPPPPLP 54 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 44 PPAPPPPPP 52 >01_02_0048 - 10626467-10627498,10628522-10628617 Length = 375 Score = 23.4 bits (48), Expect(2) = 9.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 355 PPPPPPQP 362 Score = 23.0 bits (47), Expect(2) = 9.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 352 PPLPPPPPP 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,057,846 Number of Sequences: 37544 Number of extensions: 582898 Number of successful extensions: 17501 Number of sequences better than 10.0: 196 Number of HSP's better than 10.0 without gapping: 3541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10556 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -