BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I16 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.008 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 0.037 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 0.049 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.22 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 33 0.40 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 33 0.40 SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.2 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.2 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.2 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.2 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.2 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 31 1.2 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.2 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 31 1.2 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 31 1.2 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 1.4 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 26 1.4 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.6 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 26 2.0 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 30 2.1 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.5 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.7 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 25 2.7 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.4 SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 4.9 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 4.9 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 29 4.9 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 29 4.9 SB_17195| Best HMM Match : Trypsin (HMM E-Value=4.9e-06) 29 6.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 24 7.3 SB_29144| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 28 8.6 SB_2269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 28 8.6 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1171 PSPPPPPPPPPPP 1183 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1157 PPPPPPPPPP 1166 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1158 PPPPPPPPPP 1167 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1159 PPPPPPPPPP 1168 Score = 29.1 bits (62), Expect(2) = 0.008 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1175 PPPPPPPPPP 1184 Score = 28.3 bits (60), Expect(2) = 0.008 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 1157 PPPPPPPPPPPP 1168 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP P Sbjct: 1167 PPSSPSPPPPPPPPPPPPTP 1186 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 818 PPPPPPPPPP 827 Score = 29.1 bits (62), Expect(2) = 0.037 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 819 PPPPPPPPPP 828 Score = 25.8 bits (54), Expect(2) = 0.037 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 818 PPPPPPPPPP 827 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 694 PPPPPPPPPP 703 Score = 28.3 bits (60), Expect(2) = 0.049 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPPPPPP Sbjct: 703 PLLSGTLPMPPPPPPPP 719 Score = 27.5 bits (58), Expect(2) = 0.083 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L PPPPPPP P Sbjct: 702 PPLLSGTLPMPPPPPPPPP 720 Score = 26.2 bits (55), Expect(2) = 0.049 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 712 PPPPPPPPP 720 Score = 26.2 bits (55), Expect(2) = 0.24 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 740 PPPPPPPPP 748 Score = 26.2 bits (55), Expect(2) = 0.083 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 740 PPPPPPPPP 748 Score = 25.8 bits (54), Expect(2) = 0.24 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 694 PPPPPPPPPP 703 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 26.2 bits (55), Expect(2) = 0.22 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + P PPPPPPP Sbjct: 2311 PSTGSHSPSVPPPPPPP 2327 Score = 25.8 bits (54), Expect(2) = 0.22 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 2322 PPPPPPPEQP 2331 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 74 PPLCAPPPPPPPPPPPPPPP 93 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 275 PPLCAPPPPPPPPPPPPPPP 294 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/57 (36%), Positives = 25/57 (43%) Frame = +1 Query: 232 QMGGGKVFGTLGQNDDGLFGKAGYNRXIFNDDRGKLTGQAYGTRVLGPAGDSTNYGG 402 Q G G FGT GLFG AG N G +TG +G + ST +GG Sbjct: 48 QTGFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFGQPA---SAASTGFGG 101 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 683 PPPPPPPPPPPPP 695 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 684 PPPPPPPPPPPPP 696 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 685 PPPPPPPPPPPPP 697 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 686 PPPPPPPPPPPPP 698 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 687 PPPPPPPPPPPPP 699 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 688 PPPPPPPPPPPPP 700 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 689 PPPPPPPPPPPPP 701 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 808 IXTXPFPKXXXXXPPPPXPPPXP 876 I P P PPPP PPP P Sbjct: 671 IQILPIPIQTMVPPPPPPPPPPP 693 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 692 PPPPPPPPPPQP 703 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 864 PRRPPPPPPPPPP 876 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 867 PPPPPPPPPPPPP 879 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 868 PPPPPPPPPPPPP 880 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 869 PPPPPPPPPPPPP 881 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 870 PPPPPPPPPPPPP 882 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 871 PPPPPPPPPPPPP 883 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 872 PPPPPPPPPPPPP 884 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 873 PPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P+ PPPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPP 878 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P+ PPPP PPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPP 880 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 464 PPPPPPPPPPPPP 476 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 465 PPPPPPPPPPPPP 477 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 466 PPPPPPPPPPPPP 478 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 467 PPPPPPPPPPPPP 479 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 468 PPPPPPPPPPPPP 480 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 469 PPPPPPPPPPPPP 481 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 470 PPPPPPPPPPPPP 482 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 471 PPPPPPPPPPPPP 483 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 472 PPPPPPPPPPPPP 484 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 473 PPPPPPPPPPPPP 485 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 474 PPPPPPPPPPPPP 486 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 475 PPPPPPPPPPPPP 487 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 478 PPPPPPPPPPFPP 490 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 54 PPPPPPPPPPPPP 66 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 55 PPPPPPPPPPPPP 67 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 56 PPPPPPPPPPPPP 68 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 57 PPPPPPPPPPPPP 69 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 58 PPPPPPPPPPPPP 70 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 59 PPPPPPPPPPPPP 71 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 982 PPPPPPPPPPPPP 994 Score = 25.8 bits (54), Expect(2) = 7.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 985 PPPPPPPPPP 994 Score = 21.0 bits (42), Expect(2) = 7.0 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 826 PKXXXXXPPPPXPP 867 P PPPP PP Sbjct: 946 PPPGGNAPPPPPPP 959 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 65 PTLPPPPPPPPPP 77 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 68 PPPPPPPPPPLPP 80 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 289 PTLPPPPPPPPPP 301 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 292 PPPPPPPPPPLPP 304 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 102 PPPPPPPPPPPPP 114 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 103 PPPPPPPPPPPPP 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 104 PPPPPPPPPPPPP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 105 PPPPPPPPPPPPP 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 106 PPPPPPPPPPPPP 118 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 107 PPPPPPPPPPPPP 119 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 108 PPPPPPPPPPPPP 120 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1308 PESPPPPPPPPPP 1320 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1311 PPPPPPPPPPPPP 1323 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1312 PPPPPPPPPPPPP 1324 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1313 PPPPPPPPPPPPP 1325 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1316 PPPPPPPPPPLPP 1328 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 359 PPPPPPPPPPTPP 371 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 T TT P P PPPPPP PP Sbjct: 339 TPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 367 PPPPPPPPPPSPP 379 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 375 PPSPPPPPPPPPP 387 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 378 PPPPPPPPPPSPP 390 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PPQPPPPPPPPPP 404 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 393 PQPPPPPPPPPPP 405 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 395 PPPPPPPPPPPPP 407 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 396 PPPPPPPPPPPPP 408 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 397 PPPPPPPPPPPPP 409 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 398 PPPPPPPPPPPPP 410 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 399 PPPPPPPPPPPPP 411 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 400 PPPPPPPPPPPPP 412 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 401 PPPPPPPPPPPPP 413 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 402 PPPPPPPPPPPPP 414 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 403 PPPPPPPPPPPPP 415 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 404 PPPPPPPPPPPPP 416 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 405 PPPPPPPPPPPPP 417 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 406 PPPPPPPPPPPPP 418 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 409 PPPPPPPPPPAPP 421 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 417 PPAPPPPPPPPPP 429 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 418 PAPPPPPPPPPPP 430 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 420 PPPPPPPPPPPPP 432 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N PPPPPPP PP Sbjct: 362 NMSPPPPPPPPPPPP 376 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 771 PPXXX*PLQLPLXTXXPFSXIXPXXPPPPXPPXXP 875 PP P Q P P P PPPP PP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPP 405 Score = 28.3 bits (60), Expect = 8.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P+ PPPP PPP P Sbjct: 391 PPPQPPPPPPPPPPPPPPP 409 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 211 PPPPPPPPPPPPP 223 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 212 PPPPPPPPPPPPP 224 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 375 PFAPPPPPPPPPP 387 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 768 DPPXXX*PLQLPLXTXXPFSXIXPXXPPPPXPPXXP 875 +PP P PL + P + P PPPP PP P Sbjct: 356 NPPSTPAPTPAPLSST-PCAPFAPPPPPPPPPPPAP 390 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 379 PPPPPPPPPP 388 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 379 PPPPPPPPPPAP 390 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 226 PPRPPPPPPPSPP 238 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 213 PSPPPPPPPPSP 224 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 195 PPPPPPPPPPPPP 207 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 196 PPPPPPPPPPPPP 208 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 197 PPPPPPPPPPPPP 209 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 724 PTLPPPPPPP 733 Score = 23.4 bits (48), Expect(2) = 1.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 727 PPPPPPPP 734 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 1124 PPPPPPPIP 1132 Score = 23.0 bits (47), Expect(2) = 1.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 1122 PLPPPPPPP 1130 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 797 TSXXYXPXLFXNXPXXPPPPPPP 865 TS P P PPPPPPP Sbjct: 119 TSVPSGPRAPPGGPGAPPPPPPP 141 Score = 22.2 bits (45), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 136 PPPPPPAVVP 145 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 26.2 bits (55), Expect(2) = 2.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 575 PPPPPPEPP 583 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPP Sbjct: 550 PSEEPPPPPP 559 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N P PPPPPPP P Sbjct: 452 NMPQGPPPPPPPPP 465 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 Y P + P PP PPPP PP Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPP 115 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P F P PPPP PP PP Sbjct: 83 HPPTNFSPNPPYPPPPYPPYPP 104 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/16 (68%), Positives = 11/16 (68%), Gaps = 1/16 (6%) Frame = +2 Query: 830 NXPXXPPP-PPPPXPP 874 N P PPP PPPP PP Sbjct: 171 NAPYPPPPYPPPPNPP 186 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPP PP PP Sbjct: 720 PPPPAPPPPP 729 Score = 25.4 bits (53), Expect(2) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 755 PPPPPPPAVP 764 Score = 22.6 bits (46), Expect(2) = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P P PPPPP Sbjct: 684 PPPPAPPPPP 693 Score = 22.6 bits (46), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P P PPPPP Sbjct: 720 PPPPAPPPPP 729 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 25.8 bits (54), Expect(2) = 2.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 313 PAPPPPPPPP 322 Score = 22.6 bits (46), Expect(2) = 2.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPP Sbjct: 276 PTSQPPPPPP 285 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 25.0 bits (52), Expect(2) = 2.7 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 764 LGSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPP 865 LG + ++S + P + PPPPPPP Sbjct: 253 LGLRDKHLASSSSKGHPPIPSASQNATPPPPPPP 286 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 311 PPPPPPEP 318 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 25.4 bits (53), Expect(2) = 3.4 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 797 TSXXYXPXLFXNXPXXPPPPPPP 865 T+ Y P P PPPPPP Sbjct: 419 TTPGYIPPPPPGFPQFQPPPPPP 441 Score = 22.6 bits (46), Expect(2) = 3.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 437 PPPPPPSDAP 446 >SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +1 Query: 820 PFP-KXXXXXPPPPXPPPXP 876 PFP K PPPP PPP P Sbjct: 108 PFPPKPTVATPPPPLPPPMP 127 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 T T + Y P + P PPP PP P Sbjct: 34 TTTANFTYYPHFISSSPPPPPPSPPAAAP 62 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 143 PPPPPPPSPP 152 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 2 PPPPPPPGPP 11 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 195 PPPPPPPPPP 204 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1455 PPPPPPPAPP 1464 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 794 PPPPPPPPPP 803 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 795 PPPPPPPPPP 804 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 796 PPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 794 PPPPPPPPPPPP 805 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 314 PPPPPPPPPP 323 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 315 PPPPPPPPPP 324 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 316 PPPPPPPPPP 325 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 314 PPPPPPPPPPPP 325 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 252 PPPPPPPPPP 261 >SB_17195| Best HMM Match : Trypsin (HMM E-Value=4.9e-06) Length = 379 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/65 (32%), Positives = 34/65 (52%) Frame = +1 Query: 265 GQNDDGLFGKAGYNRXIFNDDRGKLTGQAYGTRVLGPAGDSTNYGGRLXWANXNAQATXD 444 G + G++ K Y R + N+DR L G +L +G +TN GR+ N + T + Sbjct: 298 GSSGAGVYTK--YRR-VNNEDRRALIG------ILSGSGSATNSKGRIRKFNAATRITEN 348 Query: 445 LNRQI 459 ++RQI Sbjct: 349 ISRQI 353 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 24.2 bits (50), Expect(2) = 7.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 869 GGGXGGGGXXXXNXGKG 819 GGG GGGG G+G Sbjct: 515 GGGGGGGGGGGGGGGRG 531 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 875 GXGGGXGGGG 846 G GGG GGGG Sbjct: 514 GGGGGGGGGG 523 >SB_29144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = -1 Query: 243 SPHLFVPSDVT-----RVSP*GLPADRVIFRVIRRSVNFCVNTHQSCSEDIKQICIHFE 82 SPH+ DVT G +V FRV+ RS+ C+ S ++ ++C F+ Sbjct: 36 SPHILATEDVTPDEVVEAVNQGFLRGQVDFRVVARSILCCMRHEPDWSLEVVELCEKFK 94 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 432 PLPPPPPPPPQP 443 >SB_2269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 Query: 177 VIFRVIRRSVNFCVNTHQSCSEDIKQICIHFELYQVSLLKTECXKILRIPY 25 + FRV + FCV T Q S ++ I E+ V L ++ R PY Sbjct: 122 ITFRVETSQLGFCVTTSQPSSNGTSKVAI-LEVKVVRLTGEVAIQLTRTPY 171 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +1 Query: 184 SGQSSRRHPRDVTWDKQMGGGKVFGTLGQNDDGLFGKAGYNRXIFNDDRGKLTGQAYGTR 363 S +S P+ +W ++ VF D F + G+ R ++ RG+ A T Sbjct: 692 SSSTSESSPKRFSWSQENSKDVVFAGPDLPADNPFNREGFGRQSMSEKRGRAAVDAKKTE 751 Query: 364 V 366 V Sbjct: 752 V 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,735,566 Number of Sequences: 59808 Number of extensions: 544974 Number of successful extensions: 5142 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3339 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -