BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I16 (876 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC008207-1|AAH08207.1| 494|Homo sapiens hypothetical protein BC... 30 0.010 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 32 0.028 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 29 0.032 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 31 0.045 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 31 0.045 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 31 0.046 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 32 0.080 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 32 0.080 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 32 0.080 AK024492-1|BAB15782.1| 208|Homo sapiens FLJ00096 protein protein. 29 0.19 BC069026-1|AAH69026.1| 396|Homo sapiens SP5 protein protein. 29 0.23 AB096175-1|BAD34944.1| 398|Homo sapiens trans-acting transcript... 29 0.23 AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. 29 0.28 BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. 29 0.28 AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA seq... 29 0.28 AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA seq... 29 0.28 AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA seq... 29 0.28 AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA seq... 29 0.28 AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA seq... 29 0.28 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 29 0.29 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 29 0.29 AB028999-1|BAA83028.1| 804|Homo sapiens KIAA1076 protein protein. 28 0.29 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 28 0.30 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 28 0.30 S72869-1|AAC60637.1| 585|Homo sapiens H4(D10S170) protein. 28 0.30 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 29 0.30 BC064391-1|AAH64391.1| 474|Homo sapiens coiled-coil domain cont... 28 0.30 BC036757-1|AAH36757.2| 474|Homo sapiens coiled-coil domain cont... 28 0.30 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 28 0.31 AK129677-1|BAC85214.1| 168|Homo sapiens protein ( Homo sapiens ... 29 0.33 BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. 26 0.34 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 29 0.35 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 26 0.82 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 26 0.82 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 26 0.82 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 26 0.85 AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. 26 1.1 AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. 26 1.1 AL591502-3|CAI12581.1| 941|Homo sapiens gamma-aminobutyric acid... 26 1.1 AL445495-1|CAD13322.2| 941|Homo sapiens gamma-aminobutyric acid... 26 1.1 AL356282-1|CAH72233.1| 941|Homo sapiens gamma-aminobutyric acid... 26 1.1 AL353782-5|CAH71298.1| 941|Homo sapiens gamma-aminobutyric acid... 26 1.1 AJ012188-1|CAA09942.1| 941|Homo sapiens GABAB receptor, subunit... 26 1.1 AF099033-1|AAD45867.1| 941|Homo sapiens gamma-aminobutyric acid... 26 1.1 AF095784-1|AAD30389.1| 941|Homo sapiens GABA-B receptor R2 prot... 26 1.1 AF074483-1|AAD03336.1| 941|Homo sapiens GABA-B receptor 2 protein. 26 1.1 AF056085-1|AAC63228.1| 941|Homo sapiens GABA-B receptor protein. 26 1.1 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 31 1.1 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 31 1.1 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 31 1.1 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 31 1.1 AK093350-1|BAC04142.1| 231|Homo sapiens protein ( Homo sapiens ... 26 1.2 AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor ... 26 1.3 AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. 26 1.3 AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcri... 26 1.3 AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. 26 1.3 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 33 1.4 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 33 1.4 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 33 1.4 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 33 1.4 AB002383-1|BAA20839.2| 1380|Homo sapiens KIAA0385 protein. 26 1.8 BC069057-1|AAH69057.1| 1370|Homo sapiens zinc finger, MYM-type 3... 26 1.8 X95808-1|CAA65075.1| 1358|Homo sapiens DXS6673E protein. 26 1.8 AB067514-1|BAB67820.2| 1325|Homo sapiens KIAA1927 protein protein. 26 1.8 D13634-1|BAA02798.1| 314|Homo sapiens KIAA0009 protein. 33 1.8 CR456910-1|CAG33191.1| 314|Homo sapiens CHPPR protein. 33 1.8 BX537854-1|CAD97862.1| 290|Homo sapiens hypothetical protein pr... 33 1.8 BC043498-1|AAH43498.1| 333|Homo sapiens mitochondrial fission r... 33 1.8 BC036116-1|AAH36116.1| 333|Homo sapiens mitochondrial fission r... 33 1.8 BC028049-1|AAH28049.1| 525|Homo sapiens protein phosphatase 3 (... 26 1.9 M29551-1|AAA35706.1| 524|Homo sapiens protein ( Human calcineur... 26 1.9 AL359074-2|CAI52473.1| 524|Homo sapiens protein phosphatase 3 (... 26 1.9 AL353731-5|CAI52487.1| 524|Homo sapiens protein phosphatase 3 (... 26 1.9 M29550-1|AAA35705.1| 514|Homo sapiens protein ( Human calcineur... 26 1.9 AJ488506-1|CAD32694.1| 515|Homo sapiens protein phosphatase 3 c... 26 1.9 AL359074-3|CAI52474.1| 496|Homo sapiens protein phosphatase 3 (... 26 1.9 AL353731-6|CAI52488.1| 496|Homo sapiens protein phosphatase 3 (... 26 1.9 AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. 26 2.3 AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. 26 2.3 AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mix... 26 2.3 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 26 2.3 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 26 2.4 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 26 2.4 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 26 2.4 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 26 2.4 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 26 2.4 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 26 2.4 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 26 2.4 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 26 2.5 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 26 2.5 AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. 31 2.5 D38024-1|BAA07227.1| 853|Homo sapiens facioscapulohumeral muscu... 32 3.1 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 32 3.1 AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. 32 3.1 BC111564-1|AAI11565.1| 626|Homo sapiens FMNL1 protein protein. 25 3.2 AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant pr... 26 4.0 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 29 4.0 AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 4.0 AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 4.0 AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (e... 26 4.0 S56138-1|AAA14245.1| 748|Homo sapiens choline acetyltransferase... 31 4.1 S45018-1|AAB23557.2| 559|Homo sapiens choline acetyltransferase... 31 4.1 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 31 4.1 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 31 4.1 BC130617-1|AAI30618.1| 630|Homo sapiens CHAT protein protein. 31 4.1 BC130615-1|AAI30616.1| 630|Homo sapiens CHAT protein protein. 31 4.1 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 31 4.1 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 31 4.1 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 31 4.1 AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318... 31 4.1 AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318... 31 4.1 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 31 4.1 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 31 4.1 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 31 4.1 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 31 4.1 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 31 4.1 AF305909-1|AAK08955.1| 630|Homo sapiens choline acetyltransfera... 31 4.1 AF305908-1|AAK08954.1| 666|Homo sapiens choline acetyltransfera... 31 4.1 AF305907-1|AAK08953.1| 748|Homo sapiens choline acetyltransfera... 31 4.1 AF305906-3|AAK08952.1| 630|Homo sapiens choline acetyltransfera... 31 4.1 AF305906-2|AAK08951.1| 666|Homo sapiens choline acetyltransfera... 31 4.1 AF305906-1|AAK08950.1| 748|Homo sapiens choline acetyltransfera... 31 4.1 AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator pro... 31 4.1 AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. 31 4.1 AF118452-1|AAD39907.1| 348|Homo sapiens homeobox protein GBX2 p... 25 4.3 AC079135-1|AAX93240.1| 348|Homo sapiens unknown protein. 25 4.3 U31468-1|AAC03241.1| 347|Homo sapiens homeobox protein protein. 25 4.3 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 31 5.0 U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. 26 5.0 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 26 5.1 BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid ... 26 5.1 AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. 26 5.1 AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HM... 26 5.1 BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. 26 5.1 U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid... 26 5.1 BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. 26 5.3 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 26 5.3 BX537637-1|CAD97803.1| 450|Homo sapiens hypothetical protein pr... 26 5.5 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 31 5.5 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 31 5.5 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 31 5.5 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 31 5.5 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 31 5.5 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 31 5.5 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 31 5.5 L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p... 31 5.5 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 31 5.5 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 31 5.5 D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 31 5.5 D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhance... 31 5.5 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 31 5.5 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 31 5.5 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 31 5.5 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 31 5.5 BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting pr... 31 5.5 BC063297-1|AAH63297.1| 432|Homo sapiens ring finger protein 44 ... 31 5.5 BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associat... 31 5.5 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 31 5.5 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 31 5.5 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 31 5.5 BC039833-1|AAH39833.1| 432|Homo sapiens ring finger protein 44 ... 31 5.5 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 31 5.5 BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. 31 5.5 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 31 5.5 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 31 5.5 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 31 5.5 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 31 5.5 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 31 5.5 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 31 5.5 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 31 5.5 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 31 5.5 AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase me... 31 5.5 AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase me... 31 5.5 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 31 5.5 AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr... 31 5.5 AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr... 31 5.5 AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr... 31 5.5 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 31 5.5 AL353637-4|CAH70683.1| 432|Homo sapiens forkhead box B2 protein. 31 5.5 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 31 5.5 AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat... 31 5.5 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 31 5.5 AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 31 5.5 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. 31 5.5 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 31 5.5 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 31 5.5 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 31 5.5 AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. 31 5.5 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 31 5.5 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 31 5.5 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 31 5.5 AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti... 31 5.5 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 31 5.5 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 31 5.5 AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA s... 31 5.5 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 31 5.5 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 31 5.5 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 31 5.5 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 31 5.5 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 31 5.5 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 31 5.5 AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein. 31 5.5 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 31 5.5 AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 31 5.5 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 31 5.5 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 31 5.5 AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. 31 5.5 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 31 5.5 AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. 31 5.5 AB029023-1|BAA83052.2| 444|Homo sapiens KIAA1100 protein protein. 31 5.5 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 31 5.5 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 31 5.5 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 31 5.5 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 31 5.5 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 31 5.5 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 31 5.5 AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein. 31 5.5 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 31 5.5 AC004997-5|AAD43187.1| 347|Homo sapiens WUGSC:H_DJ130H16.6 prot... 26 5.6 AF069755-1|AAC99345.1| 941|Homo sapiens orphan G protein-couple... 26 6.7 AF055989-1|AAC24118.1| 757|Homo sapiens Shaw type potassium cha... 26 6.8 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 26 7.0 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 26 7.0 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 26 7.0 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 26 7.0 AL929472-6|CAH70081.1| 457|Homo sapiens mannosidase, endo-alpha... 26 7.1 AB208930-1|BAD92167.1| 428|Homo sapiens Shaw-related voltage-ga... 26 7.1 Z11585-1|CAA77671.1| 361|Homo sapiens chromosome 19 potassium c... 26 7.2 D38305-1|BAA07423.1| 345|Homo sapiens Tob protein. 26 7.2 CR541686-1|CAG46487.1| 345|Homo sapiens TOB1 protein. 26 7.2 CR536487-1|CAG38726.1| 345|Homo sapiens TOB1 protein. 26 7.2 BT019381-1|AAV38188.1| 345|Homo sapiens transducer of ERBB2, 1 ... 26 7.2 BT019380-1|AAV38187.1| 345|Homo sapiens transducer of ERBB2, 1 ... 26 7.2 BC098415-1|AAH98415.1| 345|Homo sapiens transducer of ERBB2, 1 ... 26 7.2 BC070493-1|AAH70493.1| 345|Homo sapiens transducer of ERBB2, 1 ... 26 7.2 BC031406-1|AAH31406.1| 345|Homo sapiens transducer of ERBB2, 1 ... 26 7.2 AY524047-1|AAS94256.1| 345|Homo sapiens PIG49 protein. 26 7.2 BC077730-1|AAH77730.1| 250|Homo sapiens mannosidase, endo-alpha... 26 7.5 BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IM... 26 7.6 BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subuni... 26 7.7 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 26 8.9 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 26 8.9 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 26 8.9 AB209088-1|BAD92325.1| 514|Homo sapiens synapsin II isoform IIb... 26 9.1 U80017-3|AAC52048.1| 294|Homo sapiens survival motor neuron pro... 30 9.6 U43883-1|AAC50473.1| 294|Homo sapiens survival motor neuron pro... 30 9.6 U21914-1|AAA64505.1| 293|Homo sapiens U18423; it is not known i... 30 9.6 U18423-1|AAA66242.1| 294|Homo sapiens spinal muscular atrophy d... 30 9.6 BC070242-1|AAH70242.1| 282|Homo sapiens survival of motor neuro... 30 9.6 BC062723-1|AAH62723.1| 294|Homo sapiens survival of motor neuro... 30 9.6 BC015308-1|AAH15308.1| 294|Homo sapiens survival of motor neuro... 30 9.6 BC000908-1|AAH00908.1| 282|Homo sapiens SMN1 protein protein. 30 9.6 AC005031-2|AAC62262.1| 294|Homo sapiens survival of motor neuro... 30 9.6 AC004999-1|AAC83178.1| 294|Homo sapiens survival motor neuron 1... 30 9.6 >BC008207-1|AAH08207.1| 494|Homo sapiens hypothetical protein BC008207 protein. Length = 494 Score = 30.3 bits (65), Expect(2) = 0.010 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N P PPPPPPP P Sbjct: 433 NFPLRPPPPPPPPP 446 Score = 29.1 bits (62), Expect(2) = 0.010 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 470 PPPPPPPLPP 479 Score = 27.1 bits (57), Expect(2) = 3.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPP P PP Sbjct: 469 PPPPPPPPLPPPP 481 Score = 23.4 bits (48), Expect(2) = 3.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 824 FXNXPXXPPPPPP 862 F P PPPPPP Sbjct: 434 FPLRPPPPPPPPP 446 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 31.9 bits (69), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 363 PSVLGVGPVAPPPPPPPPPP 382 Score = 31.1 bits (67), Expect(2) = 0.028 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 374 PPPPPPPPPPGPP 386 Score = 26.6 bits (56), Expect(2) = 0.028 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L + P PPPPPP Sbjct: 348 PALLSSAPSGPPPPPP 363 >AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain protein 4 protein. Length = 3599 Score = 29.1 bits (62), Expect(2) = 0.032 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 2005 PPPPPPPLPP 2014 Score = 28.3 bits (60), Expect(2) = 0.032 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 2000 PETPPPPPPPPP 2011 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 600 PVPPPPPPPPPPP 612 Score = 29.1 bits (62), Expect(2) = 0.29 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 585 PPPPPPPPPP 594 Score = 29.1 bits (62), Expect(2) = 0.045 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 586 PPPPPPPPPP 595 Score = 27.9 bits (59), Expect(2) = 0.045 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L + P PPPPPPP Sbjct: 578 PPLPGDLPPPPPPPPPP 594 Score = 25.0 bits (52), Expect(2) = 0.29 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 538 PGAAPPPPPPLP 549 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 491 PVPPPPPPPPPPP 503 Score = 29.1 bits (62), Expect(2) = 0.29 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 476 PPPPPPPPPP 485 Score = 29.1 bits (62), Expect(2) = 0.045 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 477 PPPPPPPPPP 486 Score = 27.9 bits (59), Expect(2) = 0.045 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L + P PPPPPPP Sbjct: 469 PPLPGDLPPPPPPPPPP 485 Score = 25.0 bits (52), Expect(2) = 0.29 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 429 PGAAPPPPPPLP 440 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 182 PVPPPPPPPPPPP 194 Score = 29.1 bits (62), Expect(2) = 0.29 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 167 PPPPPPPPPP 176 Score = 29.1 bits (62), Expect(2) = 0.046 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 168 PPPPPPPPPP 177 Score = 27.9 bits (59), Expect(2) = 0.046 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L + P PPPPPPP Sbjct: 160 PPLPGDLPPPPPPPPPP 176 Score = 25.0 bits (52), Expect(2) = 0.29 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 120 PGAAPPPPPPLP 131 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 31.9 bits (69), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 363 PSVLGVGPVAPPPPPPPPPP 382 Score = 31.1 bits (67), Expect(2) = 0.080 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 374 PPPPPPPPPPGPP 386 Score = 25.0 bits (52), Expect(2) = 0.080 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L + P PPPPPP Sbjct: 348 PALPSSAPSGPPPPPP 363 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 31.9 bits (69), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 363 PSVLGVGPVAPPPPPPPPPP 382 Score = 31.1 bits (67), Expect(2) = 0.080 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 374 PPPPPPPPPPGPP 386 Score = 25.0 bits (52), Expect(2) = 0.080 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L + P PPPPPP Sbjct: 348 PALPSSAPSGPPPPPP 363 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 31.9 bits (69), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 363 PSVLGVGPVAPPPPPPPPPP 382 Score = 31.1 bits (67), Expect(2) = 0.080 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 374 PPPPPPPPPPGPP 386 Score = 25.0 bits (52), Expect(2) = 0.080 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L + P PPPPPP Sbjct: 348 PALPSSAPSGPPPPPP 363 >AK024492-1|BAB15782.1| 208|Homo sapiens FLJ00096 protein protein. Length = 208 Score = 29.1 bits (62), Expect(2) = 0.19 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 115 PPPPPPPPPP 124 Score = 25.8 bits (54), Expect(2) = 0.19 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 114 PPPPPPPPPP 123 >BC069026-1|AAH69026.1| 396|Homo sapiens SP5 protein protein. Length = 396 Score = 29.1 bits (62), Expect(2) = 0.23 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 162 PPPPPPPPPP 171 Score = 25.4 bits (53), Expect(2) = 0.23 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + N PPPPPPP Sbjct: 154 PPGYSNLLPPPPPPPPP 170 >AB096175-1|BAD34944.1| 398|Homo sapiens trans-acting transcription factor 5 protein. Length = 398 Score = 29.1 bits (62), Expect(2) = 0.23 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 164 PPPPPPPPPP 173 Score = 25.4 bits (53), Expect(2) = 0.23 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + N PPPPPPP Sbjct: 156 PPGYSNLLPPPPPPPPP 172 >AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. Length = 1900 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1616 PPPPPPPGPP 1625 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1611 PPSTPPPPPPPP 1622 >BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-569E4 on chromosome 13 Contains part of a novel gene (KIAA0865), possible ortholog of rat myosin ). Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-383F12 on chromosome 13 Contains part of a novel gene (including KIAA0865), possible ortholog of rat asin A2 ). Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-54H7 on chromosome 13 Contains the 3' end a novel gene (including KIAA0865) possible ortholog of ). Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-67J18 on chromosome 13 Contains the 5' end of a novel gene (including KIAA0865), possible ortholog ). Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-141M24 on chromosome 13q33.1-34 Contains part of a novel gene, possible ortholog of rat myosin heavy ). Length = 1858 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1574 PPPPPPPGPP 1583 Score = 25.0 bits (52), Expect(2) = 0.28 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 1569 PPSTPPPPPPPP 1580 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 29.1 bits (62), Expect(2) = 0.29 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 35 PPPPPPPAPP 44 Score = 25.0 bits (52), Expect(2) = 0.29 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 20 PGPPPPPPPAPP 31 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 29.1 bits (62), Expect(2) = 0.29 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 35 PPPPPPPAPP 44 Score = 25.0 bits (52), Expect(2) = 0.29 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 20 PGPPPPPPPAPP 31 >AB028999-1|BAA83028.1| 804|Homo sapiens KIAA1076 protein protein. Length = 804 Score = 28.3 bits (60), Expect(2) = 0.29 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 425 PPQPPPPPPPPP 436 Score = 25.8 bits (54), Expect(2) = 0.29 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 430 PPPPPPPVEP 439 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 28.3 bits (60), Expect(2) = 0.30 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 579 PGAPPPPPPPPP 590 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 600 PPPPPPPMDP 609 Score = 24.6 bits (51), Expect(2) = 8.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L P PPPPPP Sbjct: 575 PPLPPGAPPPPPPPPP 590 Score = 24.2 bits (50), Expect(2) = 8.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PP PPP PP Sbjct: 625 PFGMPPAPPPPPP 637 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 28.3 bits (60), Expect(2) = 0.30 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 579 PGAPPPPPPPPP 590 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 600 PPPPPPPMDP 609 Score = 24.6 bits (51), Expect(2) = 8.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L P PPPPPP Sbjct: 575 PPLPPGAPPPPPPPPP 590 Score = 24.2 bits (50), Expect(2) = 8.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PP PPP PP Sbjct: 625 PFGMPPAPPPPPP 637 >S72869-1|AAC60637.1| 585|Homo sapiens H4(D10S170) protein. Length = 585 Score = 28.3 bits (60), Expect(2) = 0.30 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 437 PVQPPPPPPPPP 448 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 442 PPPPPPPMQP 451 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 29.1 bits (62), Expect(2) = 0.30 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 35 PPPPPPPAPP 44 Score = 25.0 bits (52), Expect(2) = 0.30 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 20 PGPPPPPPPAPP 31 >BC064391-1|AAH64391.1| 474|Homo sapiens coiled-coil domain containing 6 protein. Length = 474 Score = 28.3 bits (60), Expect(2) = 0.30 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 437 PVQPPPPPPPPP 448 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 442 PPPPPPPMQP 451 >BC036757-1|AAH36757.2| 474|Homo sapiens coiled-coil domain containing 6 protein. Length = 474 Score = 28.3 bits (60), Expect(2) = 0.30 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 437 PVQPPPPPPPPP 448 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 442 PPPPPPPMQP 451 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 28.3 bits (60), Expect(2) = 0.31 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 205 PGAPPPPPPPPP 216 Score = 25.8 bits (54), Expect(2) = 0.31 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 226 PPPPPPPMDP 235 Score = 24.6 bits (51), Expect(2) = 9.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P L P PPPPPP Sbjct: 201 PPLPPGAPPPPPPPPP 216 Score = 24.2 bits (50), Expect(2) = 9.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PP PPP PP Sbjct: 251 PFGMPPAPPPPPP 263 >AK129677-1|BAC85214.1| 168|Homo sapiens protein ( Homo sapiens cDNA FLJ26166 fis, clone ADG02852. ). Length = 168 Score = 29.1 bits (62), Expect(2) = 0.33 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 80 PPPPPPPLPP 89 Score = 25.0 bits (52), Expect(2) = 0.33 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 75 PPRAPPPPPPPP 86 >BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. Length = 489 Score = 26.2 bits (55), Expect(3) = 0.34 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 74 PPPPPPPAP 82 Score = 23.4 bits (48), Expect(3) = 0.34 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 105 PPPPPPPP 112 Score = 22.6 bits (46), Expect(3) = 0.34 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 836 PXXPPPPPPP 865 P P PPPPP Sbjct: 60 PPAPQPPPPP 69 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 29.1 bits (62), Expect(2) = 0.35 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 35 PPPPPPPAPP 44 Score = 25.0 bits (52), Expect(2) = 0.35 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 20 PGPPPPPPPAPP 31 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 557 PPPPPPPLP 565 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 570 PPPPPPLPP 578 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 550 PPPPPPPLP 558 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 563 PPPPPPLPP 571 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 550 PPPPPPPLP 558 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 563 PPPPPPLPP 571 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 26.2 bits (55), Expect(2) = 0.85 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 144 PPPPPPPLP 152 Score = 26.2 bits (55), Expect(2) = 0.85 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 157 PPPPPPLPP 165 >AB023171-1|BAA76798.2| 1183|Homo sapiens KIAA0954 protein protein. Length = 1183 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 220 PPPPPPPPP 228 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 218 PGPPPPPPPP 227 >AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. Length = 1111 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 179 PPPPPPPPP 187 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 177 PGPPPPPPPP 186 >AL591502-3|CAI12581.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AL445495-1|CAD13322.2| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AL356282-1|CAH72233.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AL353782-5|CAH71298.1| 941|Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AJ012188-1|CAA09942.1| 941|Homo sapiens GABAB receptor, subunit 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AF099033-1|AAD45867.1| 941|Homo sapiens gamma-aminobutyric acid type B receptor 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AF095784-1|AAD30389.1| 941|Homo sapiens GABA-B receptor R2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AF074483-1|AAD03336.1| 941|Homo sapiens GABA-B receptor 2 protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >AF056085-1|AAC63228.1| 941|Homo sapiens GABA-B receptor protein. Length = 941 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 12 PPPPPPPPP 20 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGPPPPPPPP 19 >BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. Length = 894 Score = 31.1 bits (67), Expect(2) = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 100 PLQPPPPPPPPPP 112 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P + P P PPPP Sbjct: 80 PPMSAQLPGIPMPPPP 95 >BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. Length = 877 Score = 31.1 bits (67), Expect(2) = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 101 PLQPPPPPPPPPP 113 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P + P P PPPP Sbjct: 81 PPMSAQLPGIPMPPPP 96 >U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated protein protein. Length = 872 Score = 31.1 bits (67), Expect(2) = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 78 PLQPPPPPPPPPP 90 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P + P P PPPP Sbjct: 58 PPMSAQLPGIPMPPPP 73 >BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein protein. Length = 799 Score = 31.1 bits (67), Expect(2) = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 103 PLQPPPPPPPPPP 115 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPP 862 P + P P PPPP Sbjct: 83 PPMSAQLPGIPMPPPP 98 >AK093350-1|BAC04142.1| 231|Homo sapiens protein ( Homo sapiens cDNA FLJ36031 fis, clone TESTI2017028. ). Length = 231 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 145 PPPPPPPPP 153 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 143 PRPPPPPPPP 152 >AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor 400 protein. Length = 3859 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 498 PSPAPVPAPPPPPPPPP 514 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 506 PPPPPPPPPP 515 >AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. Length = 3830 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 498 PSPAPVPAPPPPPPPPP 514 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 506 PPPPPPPPPP 515 >AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcription domain-associated protein variant protein. Length = 3587 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 212 PSPAPVPAPPPPPPPPP 228 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 220 PPPPPPPPPP 229 >AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. Length = 2089 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 498 PSPAPVPAPPPPPPPPP 514 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 506 PPPPPPPPPP 515 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 785 MTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 +T T+ P L P PPPPPPP PP Sbjct: 616 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 645 Score = 31.5 bits (68), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 773 PXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 P T S P P PPPPPPP PP Sbjct: 613 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPP 646 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 635 PPPPPPPPPPPPP 647 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 636 PPPPPPPPPPPPP 648 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 33.1 bits (72), Expect = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 78 PALHSAAPGLPPPPPPPPPP 97 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 90 PPPPPPPPPPLPP 102 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 785 MTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 +T T+ P L P PPPPPPP PP Sbjct: 616 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 645 Score = 31.5 bits (68), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 773 PXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 P T S P P PPPPPPP PP Sbjct: 613 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPP 646 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 635 PPPPPPPPPPPPP 647 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 636 PPPPPPPPPPPPP 648 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 33.1 bits (72), Expect = 1.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 785 MTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 +T T+ P L P PPPPPPP PP Sbjct: 602 VTPYTASQPSPPLPPPPPPPPPPPPPPPPP 631 Score = 31.5 bits (68), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 773 PXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 P T S P P PPPPPPP PP Sbjct: 599 PKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPP 632 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 621 PPPPPPPPPPPPP 633 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 622 PPPPPPPPPPPPP 634 >AB002383-1|BAA20839.2| 1380|Homo sapiens KIAA0385 protein. Length = 1380 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 828 PPPPPPPATP 837 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + P P PPPPP P Sbjct: 816 PVKTRSAPTAPTPPPPPPP 834 >BC069057-1|AAH69057.1| 1370|Homo sapiens zinc finger, MYM-type 3 protein. Length = 1370 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 818 PPPPPPPATP 827 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + P P PPPPP P Sbjct: 806 PVKTRSAPTAPTPPPPPPP 824 >X95808-1|CAA65075.1| 1358|Homo sapiens DXS6673E protein. Length = 1358 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 806 PPPPPPPATP 815 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + P P PPPPP P Sbjct: 794 PVKTRSAPTAPTPPPPPPP 812 >AB067514-1|BAB67820.2| 1325|Homo sapiens KIAA1927 protein protein. Length = 1325 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 18 PPPPPPPPAP 27 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPP P Sbjct: 7 PPLPSLPPSLSPPPPPPPP 25 >D13634-1|BAA02798.1| 314|Homo sapiens KIAA0009 protein. Length = 314 Score = 32.7 bits (71), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 161 FGTIPPHPPPPPPPLPP 177 >CR456910-1|CAG33191.1| 314|Homo sapiens CHPPR protein. Length = 314 Score = 32.7 bits (71), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 161 FGTIPPHPPPPPPPLPP 177 >BX537854-1|CAD97862.1| 290|Homo sapiens hypothetical protein protein. Length = 290 Score = 32.7 bits (71), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 137 FGTIPPHPPPPPPPLPP 153 >BC043498-1|AAH43498.1| 333|Homo sapiens mitochondrial fission regulator 1 protein. Length = 333 Score = 32.7 bits (71), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 180 FGTIPPHPPPPPPPLPP 196 >BC036116-1|AAH36116.1| 333|Homo sapiens mitochondrial fission regulator 1 protein. Length = 333 Score = 32.7 bits (71), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 180 FGTIPPHPPPPPPPLPP 196 >BC028049-1|AAH28049.1| 525|Homo sapiens protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform protein. Length = 525 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >M29551-1|AAA35706.1| 524|Homo sapiens protein ( Human calcineurin A2 mRNA, complete cds. ). Length = 524 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AL359074-2|CAI52473.1| 524|Homo sapiens protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform protein. Length = 524 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AL353731-5|CAI52487.1| 524|Homo sapiens protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform protein. Length = 524 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >M29550-1|AAA35705.1| 514|Homo sapiens protein ( Human calcineurin A1 mRNA, complete cds. ). Length = 514 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AJ488506-1|CAD32694.1| 515|Homo sapiens protein phosphatase 3 catalytic subunit beta3 protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AL359074-3|CAI52474.1| 496|Homo sapiens protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform protein. Length = 496 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AL353731-6|CAI52488.1| 496|Homo sapiens protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform protein. Length = 496 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 12 PPPPPPPPPP 21 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 4 PEPARAAPPPPPPPPPP 20 >AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. Length = 1858 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1544 PPPPPPPPP 1552 Score = 26.2 bits (55), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1715 PPPPPPPPP 1723 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 1540 NSTAPPPPPPPP 1551 Score = 22.6 bits (46), Expect(2) = 8.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPP P P Sbjct: 1680 PPPPPGPAP 1688 >AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. Length = 1858 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1544 PPPPPPPPP 1552 Score = 26.2 bits (55), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1715 PPPPPPPPP 1723 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 1540 NSTAPPPPPPPP 1551 Score = 22.6 bits (46), Expect(2) = 8.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPP P P Sbjct: 1680 PPPPPGPAP 1688 >AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia 5 protein. Length = 1778 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1464 PPPPPPPPP 1472 Score = 26.2 bits (55), Expect(2) = 8.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 1635 PPPPPPPPP 1643 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 1460 NSTAPPPPPPPP 1471 Score = 22.6 bits (46), Expect(2) = 8.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPP P P Sbjct: 1600 PPPPPGPAP 1608 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 25.8 bits (54), Expect(2) = 2.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 1441 PPPPLPPPLP 1450 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 1427 PPPPPPLALPPPPPPPP 1443 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 675 PPPPLPPPLP 684 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 661 PPPPPPLALPPPPPPPP 677 >AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated CREB protein 1 protein. Length = 650 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 396 PPPPPPPQAP 405 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 380 PPQPQPPPPPPP 391 >BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcription coactivator 1 protein. Length = 634 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 380 PPPPPPPQAP 389 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 364 PPQPQPPPPPPP 375 >AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. Length = 634 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 380 PPPPPPPQAP 389 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 364 PPQPQPPPPPPP 375 >BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. Length = 604 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 350 PPPPPPPQAP 359 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 334 PPQPQPPPPPPP 345 >AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid susceptibility protein protein. Length = 593 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 380 PPPPPPPQAP 389 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 364 PPQPQPPPPPPP 375 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 357 PPPPLPPPLP 366 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 343 PPPPPPLALPPPPPPPP 359 >BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. Length = 475 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 221 PPPPPPPQAP 230 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 205 PPQPQPPPPPPP 216 >AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. Length = 414 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 354 PPPPPPPQAP 363 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 338 PPQPQPPPPPPP 349 >AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. Length = 402 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 383 PPQPPPPPPPPPP 395 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 384 PQPPPPPPPPPPP 396 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 388 PPPPPPPPPP 397 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 823 FPKXXXXXPPPPXPPP 870 +P PPPP PPP Sbjct: 381 YPPPQPPPPPPPPPPP 396 >D38024-1|BAA07227.1| 853|Homo sapiens facioscapulohumeral muscular dystrophy protein. Length = 853 Score = 31.9 bits (69), Expect = 3.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 771 PPXXX*PLQLPLXTXXPFSXIXPXXPPPPXPP 866 PP PL LPL P + PPPP PP Sbjct: 336 PPSPLPPLPLPLRLSGPTTTTATTPPPPPPPP 367 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 31.9 bits (69), Expect = 3.1 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 764 LGSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 +G T +T P P PPPPPPP PP Sbjct: 1977 MGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPPPPPP 2013 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2002 PPPPPPPPPPPPP 2014 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2003 PPPPPPPPPPPPP 2015 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2004 PPPPPPPPPPPPP 2016 >AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. Length = 1682 Score = 31.9 bits (69), Expect = 3.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L P PPPPPPP PP Sbjct: 245 PGLPLPPPPLPPPPPPPPPP 264 >BC111564-1|AAI11565.1| 626|Homo sapiens FMNL1 protein protein. Length = 626 Score = 25.4 bits (53), Expect(2) = 3.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 262 PPPPPPGGPP 271 Score = 25.0 bits (52), Expect(2) = 3.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 256 PGAAPPPPPPPP 267 >AB210039-1|BAE06121.1| 856|Homo sapiens DKFZp761D221 variant protein protein. Length = 856 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 486 PPPPPPRPP 494 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 439 PPPPPPP 445 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 29.1 bits (62), Expect(2) = 4.0 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 331 PPPPPPPLPP 340 Score = 21.0 bits (42), Expect(2) = 4.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P Sbjct: 296 PPASIPPPPPLP 307 >AL356913-2|CAI22674.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 458 PPPPPPRPP 466 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 411 PPPPPPP 417 >AL354978-6|CAH71846.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 458 PPPPPPRPP 466 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 411 PPPPPPP 417 >AL139147-3|CAI21943.1| 828|Homo sapiens SH3-domain GRB2-like (endophilin) interacting protein 1 protein. Length = 828 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 458 PPPPPPRPP 466 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 845 PPPPPPP 865 PPPPPPP Sbjct: 411 PPPPPPP 417 >S56138-1|AAA14245.1| 748|Homo sapiens choline acetyltransferase protein. Length = 748 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 334 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 381 >S45018-1|AAB23557.2| 559|Homo sapiens choline acetyltransferase protein. Length = 559 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 224 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 271 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 31.5 bits (68), Expect = 4.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 + P PPPPPPP PP Sbjct: 174 YLTQPPPPPPPPPPLPP 190 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 31.5 bits (68), Expect = 4.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 + P PPPPPPP PP Sbjct: 174 YLTQPPPPPPPPPPLPP 190 >BC130617-1|AAI30618.1| 630|Homo sapiens CHAT protein protein. Length = 630 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 216 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 263 >BC130615-1|AAI30616.1| 630|Homo sapiens CHAT protein protein. Length = 630 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 216 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 263 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 31.5 bits (68), Expect = 4.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 + P PPPPPPP PP Sbjct: 115 YLTQPPPPPPPPPPLPP 131 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 31.5 bits (68), Expect = 4.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 798 LPLXTXXPFSXIXPXXPPPPXPPXXP 875 LPL P + P PPPP PP P Sbjct: 295 LPLLPGTPVDSLPPPLPPPPPPPPPP 320 >AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. Length = 659 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P P PPPPPPP PP Sbjct: 15 PAPLPQPPPPPPPPPPPLPP 34 >AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P P PPPPPPP PP Sbjct: 1435 HLPEQILPPPPPPPPPPPPPPP 1456 >AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P P PPPPPPP PP Sbjct: 1435 HLPEQILPPPPPPPPPPPPPPP 1456 >AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (odd-paired homolog, Drosophila) protein. Length = 663 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P P PPPPPPP PP Sbjct: 403 PDELAGLPPPPPPPPPPPPP 422 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 161 PSPPPPPPPPPPP 173 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 411 PPPPPPPPPPPPP 423 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 412 PPPPPPPPPPPPP 424 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 912 PHAGASLPPPPPPPPPPPPP 931 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 920 PPPPPPPPPPPPP 932 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 921 PPPPPPPPPPPPP 933 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 922 PPPPPPPPPPPPP 934 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 923 PPPPPPPPPPPPP 935 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 924 PPPPPPPPPPPPP 936 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 925 PPPPPPPPPPPPP 937 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 926 PPPPPPPPPPPPP 938 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 927 PPPPPPPPPPPPP 939 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 928 PPPPPPPPPPPPP 940 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 929 PPPPPPPPPPPPP 941 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 930 PPPPPPPPPPPPP 942 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 931 PPPPPPPPPPPPP 943 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 932 PPPPPPPPPPPPP 944 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 933 PPPPPPPPPPPPP 945 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 31.5 bits (68), Expect = 4.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 + P PPPPPPP PP Sbjct: 174 YLTQPPPPPPPPPPLPP 190 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P + P PPPPPPP PP Sbjct: 912 PHAGASLPPPPPPPPPPPPP 931 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 920 PPPPPPPPPPPPP 932 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 921 PPPPPPPPPPPPP 933 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 922 PPPPPPPPPPPPP 934 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 923 PPPPPPPPPPPPP 935 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 924 PPPPPPPPPPPPP 936 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 925 PPPPPPPPPPPPP 937 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 926 PPPPPPPPPPPPP 938 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 927 PPPPPPPPPPPPP 939 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 928 PPPPPPPPPPPPP 940 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 929 PPPPPPPPPPPPP 941 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 930 PPPPPPPPPPPPP 942 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 931 PPPPPPPPPPPPP 943 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 932 PPPPPPPPPPPPP 944 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 933 PPPPPPPPPPPPP 945 >AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 protein protein. Length = 639 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P P PPPPPPP PP Sbjct: 379 PDELAGLPPPPPPPPPPPPP 398 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 137 PSPPPPPPPPPPP 149 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 387 PPPPPPPPPPPPP 399 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 388 PPPPPPPPPPPPP 400 >AF305909-1|AAK08955.1| 630|Homo sapiens choline acetyltransferase isoform R protein. Length = 630 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 216 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 263 >AF305908-1|AAK08954.1| 666|Homo sapiens choline acetyltransferase isoform S protein. Length = 666 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 252 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 299 >AF305907-1|AAK08953.1| 748|Homo sapiens choline acetyltransferase isoform M protein. Length = 748 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 334 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 381 >AF305906-3|AAK08952.1| 630|Homo sapiens choline acetyltransferase isoform R protein. Length = 630 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 216 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 263 >AF305906-2|AAK08951.1| 666|Homo sapiens choline acetyltransferase isoform S protein. Length = 666 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 252 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 299 >AF305906-1|AAK08950.1| 748|Homo sapiens choline acetyltransferase isoform M protein. Length = 748 Score = 31.5 bits (68), Expect = 4.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 167 RKITRSAGNPQGDT----LVTSLGTNKWGEARSLALWDKTMMDSLEKL 298 RKI + A N L+TS G ++W EAR++ + D T DSL+ + Sbjct: 334 RKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMI 381 >AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator protein. Length = 2099 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P P PPPPPPP PP Sbjct: 1255 HLPEQILPPPPPPPPPPPPPPP 1276 >AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. Length = 2099 Score = 31.5 bits (68), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 + P P PPPPPPP PP Sbjct: 1255 HLPEQILPPPPPPPPPPPPPPP 1276 >AF118452-1|AAD39907.1| 348|Homo sapiens homeobox protein GBX2 protein. Length = 348 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P P PPPPPP P Sbjct: 45 PMFMPYRPVVLPPPPPPPP 63 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 57 PPPPPPPALP 66 >AC079135-1|AAX93240.1| 348|Homo sapiens unknown protein. Length = 348 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P P PPPPPP P Sbjct: 45 PMFMPYRPVVLPPPPPPPP 63 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 57 PPPPPPPALP 66 >U31468-1|AAC03241.1| 347|Homo sapiens homeobox protein protein. Length = 347 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P P PPPPPP P Sbjct: 45 PMFMPYRPVVLPPPPPPPP 63 Score = 25.0 bits (52), Expect(2) = 4.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 57 PPPPPPPALP 66 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1408 PAQPPPPPPPPPP 1420 Score = 25.8 bits (54), Expect(2) = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 1413 PPPPPPPPPP 1422 Score = 23.8 bits (49), Expect(2) = 5.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 1407 PPAQPPPPPPPPPPP 1421 >U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. Length = 1284 Score = 25.8 bits (54), Expect(2) = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 986 PPPPPPPPVP 995 Score = 23.8 bits (49), Expect(2) = 5.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 978 PAAPGPLPPPPPPPP 992 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 223 PPPPPPPPAP 232 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 650 PQPPPPPPPP 659 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 215 PHQAAPPPPPPPPPP 229 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPP P P P Sbjct: 632 PLLEEKPPPTPPPAPTPQP 650 >BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid and leucine rich protein 1 protein. Length = 1130 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 841 PPPPPPPPVP 850 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 833 PAAPGPLPPPPPPPP 847 >AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. Length = 1130 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 841 PPPPPPPPVP 850 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 833 PAAPGPLPPPPPPPP 847 >AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HMX3 protein. Length = 1061 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 772 PPPPPPPPVP 781 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 764 PAAPGPLPPPPPPPP 778 >BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. Length = 1048 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 759 PPPPPPPPVP 768 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 751 PAAPGPLPPPPPPPP 765 >U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid rich nuclear protein isoform protein. Length = 1021 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 723 PPPPPPPPVP 732 Score = 23.8 bits (49), Expect(2) = 5.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 715 PAAPGPLPPPPPPPP 729 >BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. Length = 743 Score = 25.8 bits (54), Expect(2) = 5.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 454 PPPPPPPPVP 463 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 446 PAAPGPLPPPPPPPP 460 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 25.8 bits (54), Expect(2) = 5.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 105 PQPPPPPPPP 114 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPP P P P Sbjct: 87 PLLEEKPPPTPPPAPTPQP 105 >BX537637-1|CAD97803.1| 450|Homo sapiens hypothetical protein protein. Length = 450 Score = 26.2 bits (55), Expect(2) = 5.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 315 PPPPPPPAP 323 Score = 23.4 bits (48), Expect(2) = 5.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 824 FXNXPXXPPPPPP 862 + P PPPPPP Sbjct: 309 YLTAPPPPPPPPP 321 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 21 PLVPPPPPPPPPP 33 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 24 PPPPPPPPPPPPP 36 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPMPPPPPPPPPP 403 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PMPPPPPPPPPPP 404 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPMPPPPPPPPPP 403 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PMPPPPPPPPPPP 404 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain protein protein. Length = 3703 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2037 PEPPPPPPPPPPP 2049 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 465 PPHPPPPPPPPPP 477 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 466 PHPPPPPPPPPPP 478 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 468 PPPPPPPPPPPPP 480 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 471 PPPPPPPPPPLPP 483 >D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhancer binding protein protein. Length = 2783 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1123 PEPPPPPPPPPPP 1135 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 56 PESPPPPPPPPPP 68 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 242 PPPPPPPPPPPPP 254 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 243 PPPPPPPPPPPPP 255 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1466 PPLPPPPPPPLPP 1478 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1474 PPLPPPPPPPLPP 1486 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 329 PPPPPPPPPPPPP 341 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 330 PPPPPPPPPPPPP 342 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 331 PPPPPPPPPPPPP 343 >BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. Length = 688 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 21 PLVPPPPPPPPPP 33 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 24 PPPPPPPPPPPPP 36 >BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting protein family, member 2 protein. Length = 440 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2 PIPPPPPPPPGPP 14 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 367 PAGPPPPPPP 376 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 370 PPPPPPPP 377 >BC063297-1|AAH63297.1| 432|Homo sapiens ring finger protein 44 protein. Length = 432 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 287 PLPPPPPPPPPPP 299 >BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associated factor 1 protein. Length = 1312 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 206 PSPPPPPPPPAPP 218 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 71 PGPPPPPPPPPPP 83 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 73 PPPPPPPPPPPPP 85 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 74 PPPPPPPPPPPPP 86 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 75 PPPPPPPPPPPPP 87 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 590 PPHPPPPPPPPPP 602 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 591 PHPPPPPPPPPPP 603 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 593 PPPPPPPPPPPPP 605 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 596 PPPPPPPPPPLPP 608 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPPPPPPPPPGPP 403 >BC039833-1|AAH39833.1| 432|Homo sapiens ring finger protein 44 protein. Length = 432 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 287 PLPPPPPPPPPPP 299 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 717 PESPPPPPPPPPP 729 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 903 PPPPPPPPPPPPP 915 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 904 PPPPPPPPPPPPP 916 >BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. Length = 308 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 127 PARPPPPPPPPPP 139 >BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 protein. Length = 688 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 21 PLVPPPPPPPPPP 33 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 24 PPPPPPPPPPPPP 36 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPMPPPPPPPPPP 403 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PMPPPPPPPPPPP 404 >BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IMAGE:3946309) protein. Length = 39 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 18 PLRPPPPPPPLPP 30 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 403 PPMPPPPPPPPPP 415 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 404 PMPPPPPPPPPPP 416 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 608 PPPPPPPPPPPPP 620 >AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 isoform c protein. Length = 546 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 21 PLVPPPPPPPPPP 33 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 24 PPPPPPPPPPPPP 36 >AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant II protein. Length = 124 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 58 PPLPPPPPPPPPP 70 >AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant I protein. Length = 153 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 58 PPLPPPPPPPPPP 70 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 558 PPLPPPPPPPPPP 570 Score = 26.2 bits (55), Expect(2) = 8.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 554 PQPQPPLPPPPPPPPPP 570 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 564 PPPPPPPQLP 573 >AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 558 PPLPPPPPPPPPP 570 Score = 26.2 bits (55), Expect(2) = 8.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 554 PQPQPPLPPPPPPPPPP 570 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 564 PPPPPPPQLP 573 >AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1220 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 558 PPLPPPPPPPPPP 570 Score = 26.2 bits (55), Expect(2) = 8.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 554 PQPQPPLPPPPPPPPPP 570 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 564 PPPPPPPQLP 573 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 466 PPMPPPPPPPPPP 478 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 467 PMPPPPPPPPPPP 479 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 469 PPPPPPPPPPPPP 481 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 470 PPPPPPPPPPPPP 482 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 471 PPPPPPPPPPPPP 483 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 472 PPPPPPPPPPPPP 484 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 473 PPPPPPPPPPPPP 485 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 474 PPPPPPPPPPPPP 486 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 475 PPPPPPPPPPPPP 487 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 476 PPPPPPPPPPPPP 488 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 477 PPPPPPPPPPPPP 489 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 478 PPPPPPPPPPPPP 490 Score = 30.7 bits (66), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N P PP PPPP PP Sbjct: 456 PETVQNGPVTPPMPPPPPPP 475 Score = 30.7 bits (66), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 465 TPPMPPPPPPPPPPPPPPPPP 485 >AL353637-4|CAH70683.1| 432|Homo sapiens forkhead box B2 protein. Length = 432 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 162 PPQPPPPPPPPPP 174 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 66 PGPPPPPPPPPPP 78 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 68 PPPPPPPPPPPPP 80 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 69 PPPPPPPPPPPPP 81 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 70 PPPPPPPPPPPPP 82 >AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulating factor 1 protein. Length = 1200 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 558 PPLPPPPPPPPPP 570 Score = 26.2 bits (55), Expect(2) = 8.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 554 PQPQPPLPPPPPPPPPP 570 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 564 PPPPPPPQLP 573 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPPPPPPPPPGPP 403 >AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens cDNA FLJ45904 fis, clone OCBBF3026361. ). Length = 1063 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 542 PPQPPPPPPPPPP 554 >AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens cDNA FLJ41677 fis, clone HCASM2002918. ). Length = 520 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 457 PPPPPPPPPPPPP 469 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 458 PPPPPPPPPPPPP 470 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 459 PPPPPPPPPPPPP 471 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 65 PPPPPPPPPPPPP 77 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 66 PPPPPPPPPPPPP 78 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 67 PPPPPPPPPPPPP 79 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 68 PPPPPPPPPPPPP 80 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 69 PPPPPPPPPPPPP 81 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 70 PPPPPPPPPPPPP 82 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 71 PPPPPPPPPPPPP 83 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 72 PPPPPPPPPPPPP 84 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 454 PPTPPPPPPPPPP 466 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 455 PTPPPPPPPPPPP 467 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 457 PPPPPPPPPPPPP 469 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 458 PPPPPPPPPPPPP 470 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 459 PPPPPPPPPPPPP 471 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 329 PPPPPPPPPPPPP 341 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 330 PPPPPPPPPPPPP 342 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 331 PPPPPPPPPPPPP 343 >AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. Length = 1766 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1171 PIPPPPPPPPLPP 1183 >AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ14966 fis, clone THYRO1000034, weakly similar to TRICHOHYALIN. ). Length = 509 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 268 PPPPPPPPPPPPP 280 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 269 PPPPPPPPPPPPP 281 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 270 PPPPPPPPPPPPP 282 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 271 PPPPPPPPPPPPP 283 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 272 PPPPPPPPPPPPP 284 >AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. Length = 1343 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 237 PSPPPPPPPPAPP 249 >AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens cDNA FLJ13283 fis, clone OVARC1001113, highly similar to Homo sapiens diaphanous 1 (HDIA1) mRNA. ). Length = 533 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 375 PPPPPPPPPPPPP 387 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 262 PESPPPPPPPPPP 274 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 448 PPPPPPPPPPPPP 460 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 449 PPPPPPPPPPPPP 461 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 127 PARPPPPPPPPPP 139 >AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. Length = 440 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2 PIPPPPPPPPGPP 14 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 367 PAGPPPPPPP 376 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 370 PPPPPPPP 377 >AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 786 PRAPPPPPPPPPP 798 >AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. Length = 903 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 786 PRAPPPPPPPPPP 798 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 71 PGPPPPPPPPPPP 83 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 73 PPPPPPPPPPPPP 85 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 74 PPPPPPPPPPPPP 86 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 75 PPPPPPPPPPPPP 87 >AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcription factor TReP-132 protein. Length = 1200 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 558 PPLPPPPPPPPPP 570 Score = 26.2 bits (55), Expect(2) = 8.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 554 PQPQPPLPPPPPPPPPP 570 Score = 22.6 bits (46), Expect(2) = 8.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 564 PPPPPPPQLP 573 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 53 PLPPPPPPPPLPP 65 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 71 PGPPPPPPPPPPP 83 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 73 PPPPPPPPPPPPP 85 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 74 PPPPPPPPPPPPP 86 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 75 PPPPPPPPPPPPP 87 >AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA splicing factor SR-A1 protein. Length = 1312 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 206 PSPPPPPPPPAPP 218 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPMPPPPPPPPPP 403 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PMPPPPPPPPPPP 404 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 599 PPPPPPPPPPPPP 611 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 590 PPHPPPPPPPPPP 602 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 591 PHPPPPPPPPPPP 603 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 593 PPPPPPPPPPPPP 605 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 596 PPPPPPPPPPLPP 608 >AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. Length = 1822 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1350 PIPPPPPPPPLPP 1362 >AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 protein. Length = 675 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 8 PLVPPPPPPPPPP 20 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 11 PPPPPPPPPPPPP 23 >AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a protein. Length = 675 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 8 PLVPPPPPPPPPP 20 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 11 PPPPPPPPPPPPP 23 >AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein. Length = 2553 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 887 PEPPPPPPPPPPP 899 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 635 PPPPPPPPPPPPP 647 >AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase kappa protein. Length = 1271 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 28 PPWPPPPPPPAPP 40 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 660 PPPPPPPPPPPPP 672 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 661 PPPPPPPPPPPPP 673 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 662 PPPPPPPPPPPPP 674 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 663 PPPPPPPPPPPPP 675 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 664 PPPPPPPPPPPPP 676 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 665 PPPPPPPPPPPPP 677 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 666 PPPPPPPPPPPPP 678 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 667 PPPPPPPPPPPPP 679 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 569 PPMPPPPPPPPPP 581 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 570 PMPPPPPPPPPPP 582 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 572 PPPPPPPPPPPPP 584 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 573 PPPPPPPPPPPPP 585 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 574 PPPPPPPPPPPPP 586 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 575 PPPPPPPPPPPPP 587 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 576 PPPPPPPPPPPPP 588 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 577 PPPPPPPPPPPPP 589 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 578 PPPPPPPPPPPPP 590 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 579 PPPPPPPPPPPPP 591 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 580 PPPPPPPPPPPPP 592 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 581 PPPPPPPPPPPPP 593 Score = 30.7 bits (66), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P N P PP PPPP PP Sbjct: 559 PETVQNGPVTPPMPPPPPPP 578 Score = 30.7 bits (66), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPPXP 876 T P P PPPP PPP P Sbjct: 568 TPPMPPPPPPPPPPPPPPPPP 588 >AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. Length = 1285 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1139 PPPPPPPPPPLPP 1151 >AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. Length = 1130 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 18 PPAPPPPPPPPPP 30 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 21 PPPPPPPPPPSPP 33 >AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. Length = 440 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2 PIPPPPPPPPGPP 14 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 367 PAGPPPPPPP 376 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 370 PPPPPPPP 377 >AB029023-1|BAA83052.2| 444|Homo sapiens KIAA1100 protein protein. Length = 444 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 299 PLPPPPPPPPPPP 311 >AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. Length = 1315 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 555 PPPPPPPPPPGPP 567 >AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. Length = 1015 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 898 PRAPPPPPPPPPP 910 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 391 PPPPPPPPPPGPP 403 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 752 PESPPPPPPPPPP 764 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 938 PPPPPPPPPPPPP 950 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 939 PPPPPPPPPPPPP 951 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1466 PPLPPPPPPPLPP 1478 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1474 PPLPPPPPPPLPP 1486 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1529 PPLPPPPPPPLPP 1541 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1537 PPLPPPPPPPLPP 1549 >AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein. Length = 1019 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 170 PAPPPPPPPPPPP 182 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 603 PQQPPPPPPPPPP 615 Score = 31.1 bits (67), Expect = 5.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 606 PPPPPPPPPPPPP 618 >AC004997-5|AAD43187.1| 347|Homo sapiens WUGSC:H_DJ130H16.6 protein. Length = 347 Score = 26.2 bits (55), Expect(2) = 7.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 14 PPPPPPPSP 22 Score = 25.8 bits (54), Expect(2) = 5.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 13 PPPPPPPPSP 22 Score = 23.8 bits (49), Expect(2) = 5.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P + PPPP PPP Sbjct: 3 PAARPALRSPPPPPPPP 19 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 12 PPPPPPPPP 20 >AF069755-1|AAC99345.1| 941|Homo sapiens orphan G protein-coupled receptor HG20 protein. Length = 941 Score = 25.8 bits (54), Expect(2) = 6.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 10 PGRPPPPPPP 19 Score = 23.4 bits (48), Expect(2) = 6.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 13 PPPPPPPP 20 >AF055989-1|AAC24118.1| 757|Homo sapiens Shaw type potassium channel Kv3.3 protein. Length = 757 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 579 PPPPPPPHP 587 Score = 23.0 bits (47), Expect(2) = 6.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 577 PDPPPPPPP 585 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 332 PPPPPPPLP 340 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 283 PHEPPPPPP 291 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 324 PPPPPPPLP 332 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 275 PHEPPPPPP 283 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 324 PPPPPPPLP 332 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 275 PHEPPPPPP 283 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 26.2 bits (55), Expect(2) = 7.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 324 PPPPPPPLP 332 Score = 23.0 bits (47), Expect(2) = 7.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 275 PHEPPPPPP 283 >AL929472-6|CAH70081.1| 457|Homo sapiens mannosidase, endo-alpha-like protein. Length = 457 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 65 PAAPPPPPPP 74 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 68 PPPPPPPP 75 >AB208930-1|BAD92167.1| 428|Homo sapiens Shaw-related voltage-gated potassium channel protein 3 variant protein. Length = 428 Score = 26.2 bits (55), Expect(2) = 7.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 279 PPPPPPPHP 287 Score = 23.0 bits (47), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 277 PDPPPPPPP 285 >Z11585-1|CAA77671.1| 361|Homo sapiens chromosome 19 potassium channel protein. Length = 361 Score = 26.2 bits (55), Expect(2) = 7.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 289 PPPPPPPHP 297 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 287 PDPPPPPPP 295 >D38305-1|BAA07423.1| 345|Homo sapiens Tob protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >CR541686-1|CAG46487.1| 345|Homo sapiens TOB1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >CR536487-1|CAG38726.1| 345|Homo sapiens TOB1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BT019381-1|AAV38188.1| 345|Homo sapiens transducer of ERBB2, 1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BT019380-1|AAV38187.1| 345|Homo sapiens transducer of ERBB2, 1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BC098415-1|AAH98415.1| 345|Homo sapiens transducer of ERBB2, 1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BC070493-1|AAH70493.1| 345|Homo sapiens transducer of ERBB2, 1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BC031406-1|AAH31406.1| 345|Homo sapiens transducer of ERBB2, 1 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >AY524047-1|AAS94256.1| 345|Homo sapiens PIG49 protein. Length = 345 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 246 PAQPPPPPPP 255 Score = 23.4 bits (48), Expect(2) = 7.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 249 PPPPPPPP 256 >BC077730-1|AAH77730.1| 250|Homo sapiens mannosidase, endo-alpha-like protein. Length = 250 Score = 25.8 bits (54), Expect(2) = 7.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 65 PAAPPPPPPP 74 Score = 23.4 bits (48), Expect(2) = 7.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 68 PPPPPPPP 75 >BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IMAGE:3895048) protein. Length = 205 Score = 25.8 bits (54), Expect(2) = 7.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 25 PGKPPPPPPP 34 Score = 23.4 bits (48), Expect(2) = 7.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 28 PPPPPPPP 35 >BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subunit 19 protein. Length = 194 Score = 25.8 bits (54), Expect(2) = 7.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 25 PGKPPPPPPP 34 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 28 PPPPPPPP 35 >BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 25.8 bits (54), Expect(2) = 8.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 599 PPPPPPPPAP 608 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPP 867 P P PPPP PP Sbjct: 547 PAPPDDFLPPPPPPPP 562 >AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 25.8 bits (54), Expect(2) = 8.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 599 PPPPPPPPAP 608 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPP 867 P P PPPP PP Sbjct: 547 PAPPDDFLPPPPPPPP 562 >AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73 protein. Length = 666 Score = 25.8 bits (54), Expect(2) = 8.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 599 PPPPPPPPAP 608 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPP 867 P P PPPP PP Sbjct: 547 PAPPDDFLPPPPPPPP 562 >AB209088-1|BAD92325.1| 514|Homo sapiens synapsin II isoform IIb variant protein. Length = 514 Score = 26.2 bits (55), Expect(2) = 9.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPP 865 Y L P PPPPPPP Sbjct: 70 YMTDLQRPEPQQPPPPPPP 88 Score = 22.6 bits (46), Expect(2) = 9.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 83 PPPPPPTASP 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,526,392 Number of Sequences: 237096 Number of extensions: 2758776 Number of successful extensions: 42970 Number of sequences better than 10.0: 260 Number of HSP's better than 10.0 without gapping: 8665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25057 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11159604822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -