BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I16 (876 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 31 0.049 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 31 0.049 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 31 0.049 BT015305-1|AAT94533.1| 1256|Drosophila melanogaster AT15166p pro... 29 0.11 AY058520-1|AAL13749.1| 1256|Drosophila melanogaster LD22771p pro... 29 0.11 AE014297-1371|AAN13524.1| 1256|Drosophila melanogaster CG6923-PB... 29 0.11 AE014297-1370|AAF54693.1| 1256|Drosophila melanogaster CG6923-PA... 29 0.11 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 29 0.12 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 32 0.31 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 32 0.31 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 32 0.31 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 32 0.31 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 32 0.31 AY094648-1|AAM11001.2| 375|Drosophila melanogaster AT09463p pro... 26 0.57 AE014296-3281|AAF49067.1| 372|Drosophila melanogaster CG7335-PA... 26 0.57 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 33 0.68 AY089563-1|AAL90301.1| 437|Drosophila melanogaster RE03249p pro... 28 0.73 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 31 0.87 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 31 0.87 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 26 0.95 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 26 0.95 BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p pro... 26 1.2 AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-P... 26 1.2 BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p pro... 26 1.2 AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-P... 26 1.2 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 31 1.5 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 31 1.5 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 27 1.6 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 26 1.9 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 26 1.9 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 26 1.9 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 26 1.9 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 31 2.1 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 31 2.1 U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. 31 2.1 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 31 2.1 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 31 2.1 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 31 2.1 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 31 2.1 AY069803-1|AAL39948.1| 856|Drosophila melanogaster SD04280p pro... 31 2.1 AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p pro... 31 2.1 AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D pro... 31 2.1 AE014298-3176|AAN09565.1| 856|Drosophila melanogaster CG14619-P... 31 2.1 AE014298-3175|AAN09564.1| 856|Drosophila melanogaster CG14619-P... 31 2.1 AE014298-3174|AAF50952.2| 856|Drosophila melanogaster CG14619-P... 31 2.1 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 31 2.1 AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC... 31 2.1 AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB... 31 2.1 AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA... 31 2.1 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 31 2.1 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 31 2.1 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 31 2.1 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 31 2.1 AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-P... 31 2.1 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 31 2.1 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 31 2.1 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 31 2.1 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 31 2.1 AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD... 26 2.5 AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p pro... 26 2.6 AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC... 26 2.6 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 26 2.6 AE014297-259|AAF52020.2| 832|Drosophila melanogaster CG31550-PB... 25 2.6 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 26 2.6 AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB... 26 2.6 AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA... 26 2.6 BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p pro... 26 2.6 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 26 2.6 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 26 2.6 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 26 2.6 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 26 2.6 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 26 2.6 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 26 2.6 AY095508-1|AAM12243.1| 433|Drosophila melanogaster AT04280p pro... 25 2.7 AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-P... 26 3.3 BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p pro... 26 3.3 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 26 3.5 AE014298-2790|AAF48905.2| 437|Drosophila melanogaster CG7349-PA... 30 3.6 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 26 4.2 BT029293-1|ABK30930.1| 681|Drosophila melanogaster RT01152p pro... 30 4.8 BT029292-1|ABK30929.1| 681|Drosophila melanogaster RT01151p pro... 30 4.8 BT029291-1|ABK30928.1| 681|Drosophila melanogaster RT01150p pro... 30 4.8 BT011329-1|AAR96121.1| 1659|Drosophila melanogaster SD20887p pro... 30 4.8 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 30 4.8 BT010123-1|AAQ22592.1| 489|Drosophila melanogaster AT19280p pro... 30 4.8 AY754058-1|AAV30852.1| 1620|Drosophila melanogaster DAXX protein. 30 4.8 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 30 4.8 AE014297-3156|AAF55998.2| 681|Drosophila melanogaster CG31160-P... 30 4.8 AE014134-1101|AAF52390.3| 1659|Drosophila melanogaster CG9537-PA... 30 4.8 AE014134-999|AAF52311.2| 381|Drosophila melanogaster CG9050-PA ... 30 4.8 AB062671-1|BAB78519.1| 1645|Drosophila melanogaster Daxx-like pr... 30 4.8 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 26 4.9 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 26 4.9 AE014297-1125|AAF54511.2| 3111|Drosophila melanogaster CG3996-PA... 26 5.0 AE014297-3287|AAF56111.2| 1383|Drosophila melanogaster CG17894-P... 25 5.4 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 25 5.4 AF070064-1|AAC72898.1| 1296|Drosophila melanogaster cap 'n' coll... 25 5.4 AF070063-1|AAC72897.1| 805|Drosophila melanogaster cap 'n' coll... 25 5.6 AE014297-3288|AAF56109.2| 805|Drosophila melanogaster CG17894-P... 25 5.6 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 26 6.1 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 26 6.1 AY058598-1|AAL13827.1| 950|Drosophila melanogaster LD29187p pro... 29 6.4 BT029033-1|ABJ16966.1| 485|Drosophila melanogaster IP02838p pro... 25 7.6 AY672641-1|AAV91002.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AY672640-1|AAV91001.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AY672639-1|AAV91000.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AY049774-1|AAL12210.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AF435469-1|AAL74413.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AF411340-1|AAL05873.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AF382403-1|AAL66188.1| 485|Drosophila melanogaster histamine-ga... 25 7.6 AE014297-2697|AAF55691.1| 485|Drosophila melanogaster CG7411-PA... 25 7.6 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 29 8.4 AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig iso... 29 8.4 AY122212-1|AAM52724.1| 658|Drosophila melanogaster LP07906p pro... 29 8.4 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 29 8.4 AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p pro... 29 8.4 AY064174-1|AAL47186.1| 1984|Drosophila melanogaster rho GTPase g... 29 8.4 AM412966-1|CAL85589.1| 265|Drosophila melanogaster Fst protein. 29 8.4 AM412964-1|CAL85587.1| 266|Drosophila melanogaster Fst protein. 29 8.4 AM412963-1|CAL85586.1| 266|Drosophila melanogaster Fst protein. 29 8.4 AF145662-1|AAD38637.1| 675|Drosophila melanogaster BcDNA.GH1071... 29 8.4 AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-P... 29 8.4 AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-P... 29 8.4 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 29 8.4 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 29 8.4 AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-P... 29 8.4 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 29 8.4 AE014296-3604|AAF51767.2| 706|Drosophila melanogaster CG32447-P... 29 8.4 AE014296-3603|AAS65094.1| 658|Drosophila melanogaster CG32447-P... 29 8.4 AE014296-900|AAF47940.2| 1984|Drosophila melanogaster CG32239-PA... 29 8.4 AE014134-1949|AAF53007.1| 675|Drosophila melanogaster CG6495-PA... 29 8.4 AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p pro... 25 8.4 AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p pro... 25 8.4 AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA... 25 8.4 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 728 PPPPPPPPPPPPP 740 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 721 PLPAFVAPPPPPPPPPPPP 739 Score = 29.1 bits (62), Expect(2) = 0.049 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPPPPP P Sbjct: 725 FVAPPPPPPPPPPPPP 740 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P P PPPPPPP Sbjct: 723 PAFVAPPPPPPPPPPPP 739 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 747 PPPPPPPPP 755 Score = 26.2 bits (55), Expect(2) = 0.049 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 747 PPPPPPPPP 755 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 738 PPPMANYGAPPPPPPPP 754 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 761 PPPPPPAP 768 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 595 PPPPPPPPPPPPP 607 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 588 PLPAFVAPPPPPPPPPPPP 606 Score = 29.1 bits (62), Expect(2) = 0.049 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPPPPP P Sbjct: 592 FVAPPPPPPPPPPPPP 607 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P P PPPPPPP Sbjct: 590 PAFVAPPPPPPPPPPPP 606 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 614 PPPPPPPPP 622 Score = 26.2 bits (55), Expect(2) = 0.049 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 614 PPPPPPPPP 622 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 605 PPPMANYGAPPPPPPPP 621 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 628 PPPPPPAP 635 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 500 PPPPPPPPPPPPP 512 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 493 PLPAFVAPPPPPPPPPPPP 511 Score = 29.1 bits (62), Expect(2) = 0.049 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPPPPP P Sbjct: 497 FVAPPPPPPPPPPPPP 512 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P P PPPPPPP Sbjct: 495 PAFVAPPPPPPPPPPPP 511 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 519 PPPPPPPPP 527 Score = 26.2 bits (55), Expect(2) = 0.049 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 519 PPPPPPPPP 527 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 510 PPPLANYGAPPPPPPPP 526 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 533 PPPPPPAP 540 >BT015305-1|AAT94533.1| 1256|Drosophila melanogaster AT15166p protein. Length = 1256 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 731 PPPPPPPMPP 740 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 726 PGHPAPPPPPPP 737 >AY058520-1|AAL13749.1| 1256|Drosophila melanogaster LD22771p protein. Length = 1256 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 731 PPPPPPPMPP 740 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 726 PGHPAPPPPPPP 737 >AE014297-1371|AAN13524.1| 1256|Drosophila melanogaster CG6923-PB, isoform B protein. Length = 1256 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 731 PPPPPPPMPP 740 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 726 PGHPAPPPPPPP 737 >AE014297-1370|AAF54693.1| 1256|Drosophila melanogaster CG6923-PA, isoform A protein. Length = 1256 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 731 PPPPPPPMPP 740 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 726 PGHPAPPPPPPP 737 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 29.1 bits (62), Expect(2) = 0.12 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 203 PPPPPPPLPP 212 Score = 25.0 bits (52), Expect(2) = 0.12 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPPPP 865 T TT+ N PPPPPPP Sbjct: 167 TTTTTTTTTTTKKPNHGQYPPPPPPP 192 Score = 25.0 bits (52), Expect(2) = 3.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 204 PPPPPPLPPP 213 Score = 23.8 bits (49), Expect(2) = 3.7 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 788 TXTTSXXYXPXLFXNXPXXPPPPP--PPXP 871 T TT+ P P PPPPP PP P Sbjct: 171 TTTTTTTKKPN-HGQYPPPPPPPPYYPPYP 199 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 645 FVAPPPPPPPPPPPPPP 661 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 640 PPLHAFVAPPPPPPPPPPPP 659 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 633 PPPPPPPPP 641 Score = 26.2 bits (55), Expect(2) = 0.68 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 668 PPPPPPPPP 676 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 668 PPPPPPPPP 676 Score = 25.0 bits (52), Expect(2) = 0.68 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 659 PPPLANYGAPPPPPPPP 675 Score = 24.2 bits (50), Expect(2) = 7.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L PPPPPPP Sbjct: 660 PPLANYGAPPPPPPPPP 676 Score = 23.4 bits (48), Expect(2) = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 682 PPPPPPAP 689 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 592 FVAPPPPPPPPPPPPPP 608 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 587 PPLHAFVAPPPPPPPPPPPP 606 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 580 PPPPPPPPP 588 Score = 26.2 bits (55), Expect(2) = 0.68 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 615 PPPPPPPPP 623 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 615 PPPPPPPPP 623 Score = 25.0 bits (52), Expect(2) = 0.68 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 606 PPPLANYGAPPPPPPPP 622 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L PPPPPPP Sbjct: 607 PPLANYGAPPPPPPPPP 623 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 629 PPPPPPAP 636 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 497 FVAPPPPPPPPPPPPPP 513 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 492 PPLHAFVAPPPPPPPPPPPP 511 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 485 PPPPPPPPP 493 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 520 PPPPPPPPP 528 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 520 PPPPPPPPP 528 Score = 25.0 bits (52), Expect(2) = 0.69 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 511 PPPLANYGAPPPPPPPP 527 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L PPPPPPP Sbjct: 512 PPLANYGAPPPPPPPPP 528 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 534 PPPPPPAP 541 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 487 FVAPPPPPPPPPPPPPP 503 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 482 PPLHAFVAPPPPPPPPPPPP 501 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 475 PPPPPPPPP 483 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 510 PPPPPPPPP 518 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 510 PPPPPPPPP 518 Score = 25.0 bits (52), Expect(2) = 0.69 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 501 PPPLANYGAPPPPPPPP 517 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L PPPPPPP Sbjct: 502 PPLANYGAPPPPPPPPP 518 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 524 PPPPPPAP 531 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXPP 874 F P PPPPPPP PP Sbjct: 487 FVAPPPPPPPPPPPPPP 503 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 482 PPLHAFVAPPPPPPPPPPPP 501 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 475 PPPPPPPPP 483 Score = 26.2 bits (55), Expect(2) = 0.69 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 510 PPPPPPPPP 518 Score = 26.2 bits (55), Expect(2) = 0.31 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 510 PPPPPPPPP 518 Score = 25.0 bits (52), Expect(2) = 0.69 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P N PPPPPPP Sbjct: 501 PPPLANYGAPPPPPPPP 517 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L PPPPPPP Sbjct: 502 PPLANYGAPPPPPPPPP 518 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 524 PPPPPPAP 531 >AY094648-1|AAM11001.2| 375|Drosophila melanogaster AT09463p protein. Length = 375 Score = 25.8 bits (54), Expect(2) = 0.57 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 22 PPEPPPPPPP 31 Score = 25.8 bits (54), Expect(2) = 0.57 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 23 PEPPPPPPPP 32 >AE014296-3281|AAF49067.1| 372|Drosophila melanogaster CG7335-PA protein. Length = 372 Score = 25.8 bits (54), Expect(2) = 0.57 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 19 PPEPPPPPPP 28 Score = 25.8 bits (54), Expect(2) = 0.57 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 P PPPPP PP Sbjct: 20 PEPPPPPPPP 29 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXPP 874 Y P P PPPPPPP PP Sbjct: 219 YKPSRPNRRPPPPPPPPPPPPP 240 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 229 PPPPPPPPPPPPP 241 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 230 PPPPPPPPPPPPP 242 >AY089563-1|AAL90301.1| 437|Drosophila melanogaster RE03249p protein. Length = 437 Score = 27.9 bits (59), Expect(2) = 0.73 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N P PPPPPPP Sbjct: 160 NAPATPPPPPPP 171 Score = 23.4 bits (48), Expect(2) = 0.73 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 165 PPPPPPPP 172 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 268 PLAPPPPPPPPPP 280 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 271 PPPPPPPPPPPPP 283 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 272 PPPPPPPPPPPPP 284 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 273 PPPPPPPPPPPPP 285 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPPP P Sbjct: 267 PPLAPPPPPPPPPPPPPPP 285 Score = 25.8 bits (54), Expect(2) = 0.87 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 276 PPPPPPPPPP 285 Score = 25.0 bits (52), Expect(2) = 0.87 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPP 870 T P PPPP PPP Sbjct: 266 TPPLAPPPPPPPPPPPPPP 284 Score = 24.2 bits (50), Expect(2) = 6.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 396 NSVMRPPPPPPP 407 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 401 PPPPPPPP 408 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 266 PLAPPPPPPPPPP 278 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 269 PPPPPPPPPPPPP 281 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 270 PPPPPPPPPPPPP 282 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 271 PPPPPPPPPPPPP 283 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPPP P Sbjct: 265 PPLAPPPPPPPPPPPPPPP 283 Score = 25.8 bits (54), Expect(2) = 0.87 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 274 PPPPPPPPPP 283 Score = 25.0 bits (52), Expect(2) = 0.87 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 814 TXPFPKXXXXXPPPPXPPP 870 T P PPPP PPP Sbjct: 264 TPPLAPPPPPPPPPPPPPP 282 Score = 24.2 bits (50), Expect(2) = 6.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 400 NSVMRPPPPPPP 411 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 405 PPPPPPPP 412 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 25.8 bits (54), Expect(2) = 0.95 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 224 PPPPPPPPKP 233 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 794 TTSXXYXPXLFXNXPXXPPPPPPPXP 871 T S P P PPP PPP P Sbjct: 108 TPSAPAPPPPSYGPPQTPPPRPPPQP 133 Score = 25.0 bits (52), Expect(2) = 0.95 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 203 PSRPQPPPPPPP 214 Score = 24.6 bits (51), Expect(2) = 9.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 220 PGYGPPPPPPPP 231 Score = 22.6 bits (46), Expect(2) = 5.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PP P PP PP Sbjct: 174 PPAPQPPSPP 183 Score = 22.6 bits (46), Expect(2) = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 226 PPPPPPKPQP 235 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 25.8 bits (54), Expect(2) = 0.95 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 224 PPPPPPPPKP 233 Score = 25.4 bits (53), Expect(2) = 5.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 794 TTSXXYXPXLFXNXPXXPPPPPPPXP 871 T S P P PPP PPP P Sbjct: 108 TPSAPAPPPPSYGPPQTPPPRPPPQP 133 Score = 25.0 bits (52), Expect(2) = 0.95 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P P PPPPP P Sbjct: 203 PSRPQPPPPPPP 214 Score = 24.6 bits (51), Expect(2) = 9.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 220 PGYGPPPPPPPP 231 Score = 22.6 bits (46), Expect(2) = 5.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PP P PP PP Sbjct: 174 PPAPQPPSPP 183 Score = 22.6 bits (46), Expect(2) = 9.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 226 PPPPPPKPQP 235 >BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p protein. Length = 605 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 395 PPPPPPAPP 403 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPPPP P Sbjct: 386 PSLPMGNPTPPPPPPAP 402 >AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-PA, isoform A protein. Length = 605 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 395 PPPPPPAPP 403 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPPPP P Sbjct: 386 PSLPMGNPTPPPPPPAP 402 >BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p protein. Length = 504 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 294 PPPPPPAPP 302 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPPPP P Sbjct: 285 PSLPMGNPTPPPPPPAP 301 >AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-PB, isoform B protein. Length = 504 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 294 PPPPPPAPP 302 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L P PPPPP P Sbjct: 285 PSLPMGNPTPPPPPPAP 301 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 779 PSYPPPPPPPPPP 791 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 782 PPPPPPPPPPPPP 794 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 785 PPPPPPPPPP 794 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 779 PSYPPPPPPPPPPPP 793 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 639 PSYPPPPPPPPPP 651 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 642 PPPPPPPPPPPPP 654 Score = 25.8 bits (54), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 645 PPPPPPPPPP 654 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 639 PSYPPPPPPPPPPPP 653 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 27.5 bits (58), Expect(2) = 1.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P + P PPPPPPP Sbjct: 227 PPYYPPYPYPPPPPPPP 243 Score = 22.6 bits (46), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 238 PPPPPPTHKP 247 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 26.2 bits (55), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 524 PPPPPPPMP 532 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 554 PPPPPPPP 561 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 26.2 bits (55), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 524 PPPPPPPMP 532 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 554 PPPPPPPP 561 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 26.2 bits (55), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 524 PPPPPPPMP 532 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 554 PPPPPPPP 561 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 26.2 bits (55), Expect(2) = 1.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 524 PPPPPPPMP 532 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 554 PPPPPPPP 561 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 335 PPPPPPPPPPPPP 347 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 336 PPPPPPPPPPPPP 348 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 337 PPPPPPPPPPPPP 349 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 25.8 bits (54), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 341 PPPPPPPPPP 350 Score = 23.8 bits (49), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 335 PPPPPPPPPPPPPPP 349 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 335 PPPPPPPPPPPPP 347 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 336 PPPPPPPPPPPPP 348 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 337 PPPPPPPPPPPPP 349 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 25.8 bits (54), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 341 PPPPPPPPPP 350 Score = 23.8 bits (49), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 335 PPPPPPPPPPPPPPP 349 >U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. Length = 452 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 60 PPPPPPPPPPPPP 72 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 150 PAPPPPPPPPPPP 162 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 152 PPPPPPPPPPPPP 164 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 153 PPPPPPPPPPPPP 165 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 154 PPPPPPPPPPPPP 166 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 155 PPPPPPPPPPPPP 167 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 156 PPPPPPPPPPPPP 168 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 157 PPPPPPPPPPPPP 169 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 235 PQPPPPPPPPPPP 247 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 237 PPPPPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 54 PPPPPPPPPP 63 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 55 PPPPPPPPPP 64 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PTPPPPPPPPPPP 404 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 476 PPPPPPPPPPPPP 488 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 477 PPPPPPPPPPPPP 489 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 478 PPPPPPPPPPPPP 490 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 658 PPPPPPPPPPPPP 670 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 659 PPPPPPPPPPPPP 671 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 660 PPPPPPPPPPPPP 672 >AY069803-1|AAL39948.1| 856|Drosophila melanogaster SD04280p protein. Length = 856 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 378 PPTPPPPPPPPPP 390 >AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p protein. Length = 481 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 89 PPPPPPPPPPPPP 101 >AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D protein. Length = 481 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 89 PPPPPPPPPPPPP 101 >AE014298-3176|AAN09565.1| 856|Drosophila melanogaster CG14619-PE, isoform E protein. Length = 856 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 378 PPTPPPPPPPPPP 390 >AE014298-3175|AAN09564.1| 856|Drosophila melanogaster CG14619-PD, isoform D protein. Length = 856 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 378 PPTPPPPPPPPPP 390 >AE014298-3174|AAF50952.2| 856|Drosophila melanogaster CG14619-PA, isoform A protein. Length = 856 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 378 PPTPPPPPPPPPP 390 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 167 PAEPPPPPPPPPP 179 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 171 PPPPPPPPPP 180 >AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC, isoform C protein. Length = 481 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 89 PPPPPPPPPPPPP 101 >AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB, isoform B protein. Length = 481 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 89 PPPPPPPPPPPPP 101 >AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA, isoform A protein. Length = 481 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 89 PPPPPPPPPPPPP 101 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 73 PPPPPPPPPPPPP 85 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 74 PPPPPPPPPPPPP 86 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 75 PPPPPPPPPPPPP 87 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 76 PPPPPPPPPPPPP 88 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 77 PPPPPPPPPPPPP 89 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 78 PPPPPPPPPPPPP 90 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 79 PPPPPPPPPPPPP 91 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 82 PPPPPPPPPPSPP 94 >AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-PC, isoform C protein. Length = 515 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PTPPPPPPPPPPP 404 >AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-PB, isoform B protein. Length = 515 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PTPPPPPPPPPPP 404 >AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-PA, isoform A protein. Length = 515 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 392 PTPPPPPPPPPPP 404 >AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-PA protein. Length = 1493 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 609 PTPPPPPPPPVPP 621 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 152 PAPPPPPPPPPPP 164 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 154 PPPPPPPPPPPPP 166 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 155 PPPPPPPPPPPPP 167 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 156 PPPPPPPPPPPPP 168 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 157 PPPPPPPPPPPPP 169 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 158 PPPPPPPPPPPPP 170 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 159 PPPPPPPPPPPPP 171 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 237 PQPPPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 239 PPPPPPPPPPPPP 251 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 56 PPPPPPPPPP 65 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 57 PPPPPPPPPP 66 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 658 PPPPPPPPPPPPP 670 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 659 PPPPPPPPPPPPP 671 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 660 PPPPPPPPPPPPP 672 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 658 PPPPPPPPPPPPP 670 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 659 PPPPPPPPPPPPP 671 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 660 PPPPPPPPPPPPP 672 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 463 PPPPPPPPPPPPP 475 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 464 PPPPPPPPPPPPP 476 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 465 PPPPPPPPPPPPP 477 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 466 PPPPPPPPPPPPP 478 Score = 31.1 bits (67), Expect = 2.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 467 PPPPPPPPPPPPP 479 >AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD, isoform D protein. Length = 918 Score = 26.2 bits (55), Expect(2) = 2.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 104 PPPPPPPQP 112 Score = 23.0 bits (47), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 126 PPPPPPQQP 134 >AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p protein. Length = 836 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 181 PPPPPPPQP 189 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 203 PPPPPPQQP 211 >AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC, isoform C protein. Length = 836 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 181 PPPPPPPQP 189 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 203 PPPPPPQQP 211 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 613 PGAPPPPPPP 622 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 616 PPPPPPPP 623 >AE014297-259|AAF52020.2| 832|Drosophila melanogaster CG31550-PB, isoform B protein. Length = 832 Score = 25.0 bits (52), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 281 PPPPPPPQLP 290 Score = 24.2 bits (50), Expect(2) = 2.6 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +2 Query: 767 GSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPP 865 G P + + P PPPPPPP Sbjct: 254 GPPQMQLPAAFFHGHLPLHLHPAAVAPPPPPPP 286 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 612 PGAPPPPPPP 621 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 615 PPPPPPPP 622 >AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB, isoform B protein. Length = 759 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 104 PPPPPPPQP 112 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 126 PPPPPPQQP 134 >AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA, isoform A protein. Length = 759 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 104 PPPPPPPQP 112 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 126 PPPPPPQQP 134 >BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p protein. Length = 756 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 104 PPPPPPPQP 112 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP P Sbjct: 126 PPPPPPQQP 134 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 470 PGAPPPPPPP 479 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 473 PPPPPPPP 480 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 470 PGAPPPPPPP 479 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 473 PPPPPPPP 480 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 467 PGAPPPPPPP 476 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 470 PPPPPPPP 477 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 467 PGAPPPPPPP 476 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 470 PPPPPPPP 477 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 467 PGAPPPPPPP 476 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 470 PPPPPPPP 477 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 467 PGAPPPPPPP 476 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 470 PPPPPPPP 477 >AY095508-1|AAM12243.1| 433|Drosophila melanogaster AT04280p protein. Length = 433 Score = 25.0 bits (52), Expect(2) = 2.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 281 PPPPPPPQLP 290 Score = 24.2 bits (50), Expect(2) = 2.7 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +2 Query: 767 GSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPP 865 G P + + P PPPPPPP Sbjct: 254 GPPQMQLPAAFFHGHLPLHLHPAAVAPPPPPPP 286 >AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-PA protein. Length = 1013 Score = 25.8 bits (54), Expect(2) = 3.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P P PPPPP P Sbjct: 179 PLLPTRDPTSPLPPPPPVP 197 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PP PPP PP Sbjct: 215 PPAPPPEPP 223 >BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p protein. Length = 994 Score = 25.8 bits (54), Expect(2) = 3.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P P PPPPP P Sbjct: 179 PLLPTRDPTSPLPPPPPVP 197 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 848 PPPPPPXPP 874 PP PPP PP Sbjct: 215 PPAPPPEPP 223 >EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-peptidase protein. Length = 528 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 229 PPPPPPPPLP 238 Score = 23.0 bits (47), Expect(2) = 3.5 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPP PPP Sbjct: 219 PVPTITSSPAPPPPPPP 235 >AE014298-2790|AAF48905.2| 437|Drosophila melanogaster CG7349-PA protein. Length = 437 Score = 30.3 bits (65), Expect = 3.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 830 NXPXXPPPPPPPXP 871 N P PPPPPPP P Sbjct: 160 NAPATPPPPPPPPP 173 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 25.8 bits (54), Expect(2) = 4.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 32 PAPPPKPRPPPPPPPPP 48 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 70 PPPPPPSAPP 79 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 72 PPPPSAPPPP 81 Score = 21.8 bits (44), Expect(2) = 7.1 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXP 871 + P + N P P PPP P Sbjct: 18 HFPYVPDNFPTPSAPAPPPKP 38 >BT029293-1|ABK30930.1| 681|Drosophila melanogaster RT01152p protein. Length = 681 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 +F N PPPPPPP P Sbjct: 498 MFANQTPPPPPPPPPLP 514 >BT029292-1|ABK30929.1| 681|Drosophila melanogaster RT01151p protein. Length = 681 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 +F N PPPPPPP P Sbjct: 498 MFANQTPPPPPPPPPLP 514 >BT029291-1|ABK30928.1| 681|Drosophila melanogaster RT01150p protein. Length = 681 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 +F N PPPPPPP P Sbjct: 498 MFANQTPPPPPPPPPLP 514 >BT011329-1|AAR96121.1| 1659|Drosophila melanogaster SD20887p protein. Length = 1659 Score = 29.9 bits (64), Expect = 4.8 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -2 Query: 428 AXLFAQXRRPP*-LVLSPAGPKTLVP*A*PVSLPRSSLKI-XLL*PAFPKSPSSFCPKVP 255 A L Q + P +V+ P PKT V P LP++ L + P P S P+ P Sbjct: 702 AGLLQQQQMPQKKIVMQPQLPKTSVVLPRPQQLPKNPLLVAQQQSPKTPLVNSVMGPQFP 761 Query: 254 KTLPPPICLSQVTSRGCRLEDCPLIE 177 P ++Q+T + ++ P+++ Sbjct: 762 SQQPSLPVVNQITHKSMTIQRLPMLQ 787 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPPP P Sbjct: 1284 PPLPLTPPAAPPPPPPPPP 1302 >BT010123-1|AAQ22592.1| 489|Drosophila melanogaster AT19280p protein. Length = 489 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 +F N PPPPPPP P Sbjct: 301 MFANQTPPPPPPPPPLP 317 >AY754058-1|AAV30852.1| 1620|Drosophila melanogaster DAXX protein. Length = 1620 Score = 29.9 bits (64), Expect = 4.8 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -2 Query: 428 AXLFAQXRRPP*-LVLSPAGPKTLVP*A*PVSLPRSSLKI-XLL*PAFPKSPSSFCPKVP 255 A L Q + P +V+ P PKT V P LP++ L + P P S P+ P Sbjct: 664 AGLLQQQQMPQKKIVMQPQLPKTSVVLPRPQQLPKNPLLVAQQQSPKTPLVNSVMGPQFP 723 Query: 254 KTLPPPICLSQVTSRGCRLEDCPLIE 177 P ++Q+T + ++ P+++ Sbjct: 724 SQQPSLPVVNQITHKSMTIQRLPMLQ 749 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L P PPPPPPP P Sbjct: 1344 PPLPLTPPAAPPPPPPPPP 1362 >AE014297-3156|AAF55998.2| 681|Drosophila melanogaster CG31160-PA protein. Length = 681 Score = 29.9 bits (64), Expect = 4.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 821 LFXNXPXXPPPPPPPXP 871 +F N PPPPPPP P Sbjct: 498 MFANQTPPPPPPPPPLP 514 >AE014134-1101|AAF52390.3| 1659|Drosophila melanogaster CG9537-PA protein. Length = 1659 Score = 29.9 bits (64), Expect = 4.8 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -2 Query: 428 AXLFAQXRRPP*-LVLSPAGPKTLVP*A*PVSLPRSSLKI-XLL*PAFPKSPSSFCPKVP 255 A L Q + P +V+ P PKT V P LP++ L + P P S P+ P Sbjct: 702 AGLLQQQQMPQKKIVMQPQLPKTSVVLPRPQQLPKNPLLVAQQQSPKTPLVNSVMGPQFP 761 Query: 254 KTLPPPICLSQVTSRGCRLEDCPLIE 177 P ++Q+T + ++ P+++ Sbjct: 762 SQQPSLPVVNQITHKSMTIQRLPMLQ 787 >AE014134-999|AAF52311.2| 381|Drosophila melanogaster CG9050-PA protein. Length = 381 Score = 29.9 bits (64), Expect = 4.8 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 764 LGSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXP 871 L +P + T+ Y + P PPPPPPP P Sbjct: 287 LSTPLASKSSTSQVEYDDQKYVT-PTAPPPPPPPAP 321 >AB062671-1|BAB78519.1| 1645|Drosophila melanogaster Daxx-like protein protein. Length = 1645 Score = 29.9 bits (64), Expect = 4.8 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 2/86 (2%) Frame = -2 Query: 428 AXLFAQXRRPP*-LVLSPAGPKTLVP*A*PVSLPRSSLKI-XLL*PAFPKSPSSFCPKVP 255 A L Q + P +V+ P PKT V P LP++ L + P P S P+ P Sbjct: 688 AGLLQQQQMPQKKIVMQPQLPKTSVVLPRPQQLPKNPLLVAQQQSPKTPLVNSVMGPQFP 747 Query: 254 KTLPPPICLSQVTSRGCRLEDCPLIE 177 P ++Q+T + ++ P+++ Sbjct: 748 SQQPSLPVVNQITHKSMTIQRLPMLQ 773 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 25.8 bits (54), Expect(2) = 4.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 50 PAPPPKPRPPPPPPPPP 66 Score = 25.8 bits (54), Expect(2) = 8.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 88 PPPPPPSAPP 97 Score = 22.6 bits (46), Expect(2) = 4.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 90 PPPPSAPPPP 99 Score = 21.8 bits (44), Expect(2) = 8.2 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXP 871 + P + N P P PPP P Sbjct: 36 HFPYVPDNFPTPSAPAPPPKP 56 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 25.8 bits (54), Expect(2) = 4.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 50 PAPPPKPRPPPPPPPPP 66 Score = 25.8 bits (54), Expect(2) = 8.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP PP Sbjct: 88 PPPPPPSAPP 97 Score = 22.6 bits (46), Expect(2) = 4.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 90 PPPPSAPPPP 99 Score = 21.8 bits (44), Expect(2) = 8.2 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 809 YXPXLFXNXPXXPPPPPPPXP 871 + P + N P P PPP P Sbjct: 36 HFPYVPDNFPTPSAPAPPPKP 56 >AE014297-1125|AAF54511.2| 3111|Drosophila melanogaster CG3996-PA protein. Length = 3111 Score = 25.8 bits (54), Expect(2) = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 1491 PSPPPPPPPP 1500 Score = 22.2 bits (45), Expect(2) = 5.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 1495 PPPPPPKERP 1504 >AE014297-3287|AAF56111.2| 1383|Drosophila melanogaster CG17894-PC, isoform C protein. Length = 1383 Score = 24.6 bits (51), Expect(2) = 5.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 740 NATLQPPPPPPP 751 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 745 PPPPPPPP 752 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 24.6 bits (51), Expect(2) = 5.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPP 865 P L + PPPPPPP Sbjct: 1262 PPLPPSRTSAPPPPPPP 1278 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 1272 PPPPPPPP 1279 >AF070064-1|AAC72898.1| 1296|Drosophila melanogaster cap 'n' collar isoform C protein. Length = 1296 Score = 24.6 bits (51), Expect(2) = 5.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 653 NATLQPPPPPPP 664 Score = 23.4 bits (48), Expect(2) = 5.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 658 PPPPPPPP 665 >AF070063-1|AAC72897.1| 805|Drosophila melanogaster cap 'n' collar isoform B protein. Length = 805 Score = 24.6 bits (51), Expect(2) = 5.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 162 NATLQPPPPPPP 173 Score = 23.4 bits (48), Expect(2) = 5.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 167 PPPPPPPP 174 >AE014297-3288|AAF56109.2| 805|Drosophila melanogaster CG17894-PB, isoform B protein. Length = 805 Score = 24.6 bits (51), Expect(2) = 5.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 162 NATLQPPPPPPP 173 Score = 23.4 bits (48), Expect(2) = 5.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 167 PPPPPPPP 174 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 25.8 bits (54), Expect(2) = 6.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 151 PSLPPPPPPP 160 Score = 22.2 bits (45), Expect(2) = 6.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 155 PPPPPPVVAP 164 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 25.8 bits (54), Expect(2) = 6.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 151 PSLPPPPPPP 160 Score = 22.2 bits (45), Expect(2) = 6.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 155 PPPPPPVVAP 164 >AY058598-1|AAL13827.1| 950|Drosophila melanogaster LD29187p protein. Length = 950 Score = 29.5 bits (63), Expect = 6.4 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = -2 Query: 392 LVLSPAGPKTLVP*A*PVSLPRSSLKI-XLL*PAFPKSPSSFCPKVPKTLPPPICLSQVT 216 +V+ P PKT V P LP++ L + P P S P+ P P ++Q+T Sbjct: 6 IVMQPQLPKTSVVLPRPQQLPKNPLLVAQQQSPKTPLVNSVMGPQFPSQQPSLPVVNQIT 65 Query: 215 SRGCRLEDCPLIE 177 + ++ P+++ Sbjct: 66 HKSMTIQRLPMLQ 78 >BT029033-1|ABJ16966.1| 485|Drosophila melanogaster IP02838p protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AY672641-1|AAV91002.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AY672640-1|AAV91001.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AY672639-1|AAV91000.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AY049774-1|AAL12210.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit A protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AF435469-1|AAL74413.1| 485|Drosophila melanogaster histamine-gated chloride channelalpha1 subunit protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AF411340-1|AAL05873.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit 1 protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AF382403-1|AAL66188.1| 485|Drosophila melanogaster histamine-gated chloride channelsubunit 2 protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >AE014297-2697|AAF55691.1| 485|Drosophila melanogaster CG7411-PA protein. Length = 485 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPP P Sbjct: 422 PTIAPPPPPPQP 433 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPP P P Sbjct: 427 PPPPPQPAAP 436 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 713 PPPPPPPAPP 722 >AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig isoform I protein. Length = 1400 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 278 PPPPPPPPPP 287 >AY122212-1|AAM52724.1| 658|Drosophila melanogaster LP07906p protein. Length = 658 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P F P PPPP PP PP Sbjct: 561 PHPFCYYPPAPPPPLPPQPP 580 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 172 PPPPPPPAPP 181 >AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p protein. Length = 1400 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 278 PPPPPPPPPP 287 >AY064174-1|AAL47186.1| 1984|Drosophila melanogaster rho GTPase guanine nucleotideexchange factor GEF64C protein. Length = 1984 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 821 LFXNXPXXPPPPPPP 865 LF P PPPPPPP Sbjct: 903 LFQRRPTEPPPPPPP 917 >AM412966-1|CAL85589.1| 265|Drosophila melanogaster Fst protein. Length = 265 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 96 PPPPPPPPPP 105 >AM412964-1|CAL85587.1| 266|Drosophila melanogaster Fst protein. Length = 266 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 96 PPPPPPPPPP 105 >AM412963-1|CAL85586.1| 266|Drosophila melanogaster Fst protein. Length = 266 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 96 PPPPPPPPPP 105 >AF145662-1|AAD38637.1| 675|Drosophila melanogaster BcDNA.GH10711 protein. Length = 675 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 321 PPPPPPPPPP 330 >AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-PA, isoform A protein. Length = 858 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 524 PPPPPPPPPP 533 >AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-PB, isoform B protein. Length = 968 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 634 PPPPPPPPPP 643 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 435 PPPPPPPAPP 444 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 435 PPPPPPPAPP 444 >AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-PF, isoform F protein. Length = 1400 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 278 PPPPPPPPPP 287 >AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-PA protein. Length = 695 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 356 PPPPPPPPPP 365 >AE014296-3604|AAF51767.2| 706|Drosophila melanogaster CG32447-PA, isoform A protein. Length = 706 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P F P PPPP PP PP Sbjct: 609 PHPFCYYPPAPPPPLPPQPP 628 >AE014296-3603|AAS65094.1| 658|Drosophila melanogaster CG32447-PB, isoform B protein. Length = 658 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P F P PPPP PP PP Sbjct: 561 PHPFCYYPPAPPPPLPPQPP 580 >AE014296-900|AAF47940.2| 1984|Drosophila melanogaster CG32239-PA protein. Length = 1984 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 821 LFXNXPXXPPPPPPP 865 LF P PPPPPPP Sbjct: 903 LFQRRPTEPPPPPPP 917 >AE014134-1949|AAF53007.1| 675|Drosophila melanogaster CG6495-PA protein. Length = 675 Score = 29.1 bits (62), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 321 PPPPPPPPPP 330 >AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p protein. Length = 165 Score = 25.0 bits (52), Expect(2) = 8.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 869 GGGXGGGGXXXXNXGKG 819 GGG GGGG N G G Sbjct: 33 GGGGGGGGGMRGNDGGG 49 Score = 22.6 bits (46), Expect(2) = 8.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 875 GXGGGXGGGG 846 G GGG GGGG Sbjct: 30 GVGGGGGGGG 39 >AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p protein. Length = 165 Score = 25.0 bits (52), Expect(2) = 8.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 869 GGGXGGGGXXXXNXGKG 819 GGG GGGG N G G Sbjct: 33 GGGGGGGGGMRGNDGGG 49 Score = 22.6 bits (46), Expect(2) = 8.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 875 GXGGGXGGGG 846 G GGG GGGG Sbjct: 30 GVGGGGGGGG 39 >AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA protein. Length = 165 Score = 25.0 bits (52), Expect(2) = 8.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 869 GGGXGGGGXXXXNXGKG 819 GGG GGGG N G G Sbjct: 33 GGGGGGGGGMRGNDGGG 49 Score = 22.6 bits (46), Expect(2) = 8.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 875 GXGGGXGGGG 846 G GGG GGGG Sbjct: 30 GVGGGGGGGG 39 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,252,057 Number of Sequences: 53049 Number of extensions: 888205 Number of successful extensions: 16666 Number of sequences better than 10.0: 134 Number of HSP's better than 10.0 without gapping: 3809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10529 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4250176164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -