BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I16 (876 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 34 0.12 U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cyt... 29 0.16 U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cyt... 29 0.17 Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical pr... 29 0.21 Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical pr... 29 0.21 Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical pr... 29 0.21 L23646-1|AAA28041.1| 244|Caenorhabditis elegans Hypothetical pr... 26 0.30 Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 32 0.47 U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hed... 28 0.49 U64857-7|AAC25861.2| 373|Caenorhabditis elegans Groundhog (hedg... 25 0.65 M93256-1|AAB59181.1| 1110|Caenorhabditis elegans tra-1 protein. 29 0.77 AL117202-5|CAB61040.2| 1109|Caenorhabditis elegans Hypothetical ... 29 0.77 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 29 0.81 Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical pr... 31 1.1 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 31 1.1 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 31 1.1 U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical pr... 31 1.1 U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical pr... 31 1.1 AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical ... 31 1.1 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 31 1.1 AF022981-6|AAY86319.1| 202|Caenorhabditis elegans Hypothetical ... 27 1.1 AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ... 29 1.3 Z50875-1|CAA90776.1| 1872|Caenorhabditis elegans Hypothetical pr... 25 1.6 AL021180-3|CAA15982.1| 1872|Caenorhabditis elegans Hypothetical ... 25 1.6 AC025716-19|AAK39602.2| 549|Caenorhabditis elegans Hypothetical... 30 1.9 Z19158-2|CAA79571.3| 262|Caenorhabditis elegans Hypothetical pr... 25 1.9 AL132860-5|CAB60515.1| 798|Caenorhabditis elegans Hypothetical ... 30 2.5 AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily a... 30 2.5 Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical pr... 25 2.7 Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical pr... 25 2.7 AC024859-11|AAK29981.1| 933|Caenorhabditis elegans Hypothetical... 25 3.7 AC024859-10|ABA00158.1| 832|Caenorhabditis elegans Hypothetical... 25 3.8 Z81592-1|CAB04725.1| 695|Caenorhabditis elegans Hypothetical pr... 24 3.8 Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical pr... 29 4.4 U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (gr... 29 4.4 AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAue... 29 4.4 AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical ... 29 4.4 AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical ... 29 4.4 AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical... 29 4.4 AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical... 29 4.4 AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. 29 4.4 AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated... 29 4.4 AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated... 29 4.4 AF078789-1|AAK21515.1| 392|Caenorhabditis elegans Hypothetical ... 29 5.8 AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical... 26 6.4 AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein p... 26 6.4 Z93372-4|CAB07546.1| 301|Caenorhabditis elegans Hypothetical pr... 23 6.9 Z81543-3|CAB04425.1| 322|Caenorhabditis elegans Hypothetical pr... 28 7.6 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 28 7.6 AF039720-9|AAK68360.2| 676|Caenorhabditis elegans Hypothetical ... 28 7.6 AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase assoc... 28 7.6 AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase assoc... 28 7.6 Z81129-3|CAB03404.1| 1262|Caenorhabditis elegans Hypothetical pr... 23 7.8 AF026212-3|AAF99974.2| 1172|Caenorhabditis elegans Hypothetical ... 23 7.9 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 767 GSPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 G T TT+ P F P PPPP PP PP Sbjct: 761 GGDDMSSTSTTTTTTIPPPFFALPVPPPPPVPPPPP 796 >U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform b protein. Length = 781 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPP PP Sbjct: 603 NRPHAVPPPPPPPPP 617 Score = 26.2 bits (55), Expect(2) = 0.16 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 630 PPPPPPPPP 638 Score = 26.2 bits (55), Expect(2) = 0.16 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 649 PPPPPPPPP 657 >U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform a protein. Length = 607 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPP PP Sbjct: 429 NRPHAVPPPPPPPPP 443 Score = 26.2 bits (55), Expect(2) = 0.17 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPPP P Sbjct: 456 PPPPPPPPP 464 Score = 26.2 bits (55), Expect(2) = 0.17 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 475 PPPPPPPPP 483 >Z48367-4|CAA88324.1| 1110|Caenorhabditis elegans Hypothetical protein C33B4.3a protein. Length = 1110 Score = 29.1 bits (62), Expect(2) = 0.21 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 765 PPPPPPPPPP 774 Score = 26.2 bits (55), Expect(2) = 2.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 808 PPPPPPPPP 816 Score = 23.0 bits (47), Expect(2) = 0.21 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 721 PKTPPPPPP 729 Score = 22.2 bits (45), Expect(2) = 2.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPP P Sbjct: 794 PPPPPPLPP 802 >Z66511-5|CAA91317.1| 1095|Caenorhabditis elegans Hypothetical protein F07A11.4 protein. Length = 1095 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 360 PPPPPPPPPP 369 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 361 PPPPPPPPPP 370 Score = 26.2 bits (55), Expect(2) = 0.21 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P+ PPPP PPP Sbjct: 353 PQPQSLVPPPPPPPPPP 369 Score = 25.8 bits (54), Expect(2) = 0.21 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 361 PPPPPPPPPP 370 >Z48367-5|CAE54886.1| 993|Caenorhabditis elegans Hypothetical protein C33B4.3b protein. Length = 993 Score = 29.1 bits (62), Expect(2) = 0.21 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 765 PPPPPPPPPP 774 Score = 26.2 bits (55), Expect(2) = 2.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 848 PPPPPPXPP 874 PPPPPP PP Sbjct: 808 PPPPPPPPP 816 Score = 23.0 bits (47), Expect(2) = 0.21 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 721 PKTPPPPPP 729 Score = 22.2 bits (45), Expect(2) = 2.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 845 PPPPPPPXP 871 PPPPPP P Sbjct: 794 PPPPPPLPP 802 >L23646-1|AAA28041.1| 244|Caenorhabditis elegans Hypothetical protein F44E2.3 protein. Length = 244 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 76 PKLPPPPPPP 85 Score = 25.8 bits (54), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 80 PPPPPPPSDP 89 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 770 SPXFXMTXTTSXXYXPXLFXNXPXXPPPPPPPXPP 874 SP T P + P PPPPPPP PP Sbjct: 335 SPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPP 369 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 358 PPPPPPPPPPPPP 370 >U41543-12|AAZ91345.1| 401|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 7 protein. Length = 401 Score = 28.3 bits (60), Expect(2) = 0.49 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 24 PQPPPPPPPPKP 35 Score = 22.6 bits (46), Expect(2) = 0.49 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 28 PPPPPPKPAP 37 >U64857-7|AAC25861.2| 373|Caenorhabditis elegans Groundhog (hedgehog-like family)protein 8 protein. Length = 373 Score = 25.4 bits (53), Expect(2) = 0.65 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 232 PPPPPPPPGP 241 Score = 25.0 bits (52), Expect(2) = 0.65 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 824 FXNXPXXPPPPPPPXP 871 F P PPPPPP P Sbjct: 224 FVPVPVVIPPPPPPPP 239 >M93256-1|AAB59181.1| 1110|Caenorhabditis elegans tra-1 protein. Length = 1110 Score = 29.1 bits (62), Expect(2) = 0.77 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1078 PPPPPPPAPP 1087 Score = 21.0 bits (42), Expect(2) = 0.77 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P Sbjct: 1073 PIYALPPPPPPP 1084 >AL117202-5|CAB61040.2| 1109|Caenorhabditis elegans Hypothetical protein Y47D3A.6a protein. Length = 1109 Score = 29.1 bits (62), Expect(2) = 0.77 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 1077 PPPPPPPAPP 1086 Score = 21.0 bits (42), Expect(2) = 0.77 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPP P Sbjct: 1072 PIYALPPPPPPP 1083 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 512 PPPPPPPPPP 521 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 513 PPPPPPPPPP 522 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 514 PPPPPPPPPP 523 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 512 PPPPPPPPPPPP 523 Score = 25.8 bits (54), Expect(2) = 0.81 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 514 PPPPPPPPPP 523 Score = 24.2 bits (50), Expect(2) = 0.81 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 508 PSSVPPPPPPPPPPP 522 >Z78013-1|CAB01425.3| 1140|Caenorhabditis elegans Hypothetical protein F15B9.4 protein. Length = 1140 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 573 PGGPPPPPPPPPP 585 Score = 23.4 bits (48), Expect(3) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 551 PPPPPPLP 558 Score = 21.8 bits (44), Expect(3) = 2.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 815 PXLFXNXPXXPPPPP 859 P + + P PPPPP Sbjct: 494 PSINGHAPNPPPPPP 508 Score = 21.0 bits (42), Expect(3) = 2.6 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 845 PPPPPP 862 PPPPPP Sbjct: 538 PPPPPP 543 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 137 PPSPPPPPPPPPP 149 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P P P PPPPP PP Sbjct: 128 PQYIEAPPPPPSPPPPPPPP 147 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 140 PPPPPPPPPP 149 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 134 PPPPPSPPPPPPPPP 148 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 60 PMCPPPPPPPPPP 72 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P F P PPPPPP PP Sbjct: 52 PPQFCPPPPMCPPPPPPPPP 71 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 63 PPPPPPPPPP 72 Score = 21.0 bits (42), Expect(2) = 7.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PP P PPP Sbjct: 32 PPPPPMCAPPPLPCPPP 48 >U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical protein R144.4a protein. Length = 360 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2 PPPPPPPPPPPPP 14 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 3 PPPPPPPPPPPPP 15 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 4 PPPPPPPPPPPPP 16 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 5 PPPPPPPPPPPPP 17 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 8 PPPPPPPPPP 17 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPP 16 >U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical protein R144.4b protein. Length = 362 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 2 PPPPPPPPPPPPP 14 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 3 PPPPPPPPPPPPP 15 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 4 PPPPPPPPPPPPP 16 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 5 PPPPPPPPPPPPP 17 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 8 PPPPPPPPPP 17 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 826 PKXXXXXPPPPXPPP 870 P PPPP PPP Sbjct: 2 PPPPPPPPPPPPPPP 16 >AF043706-2|AAB97604.2| 730|Caenorhabditis elegans Hypothetical protein ZC123.1 protein. Length = 730 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 138 PAAPPPPPPPPPP 150 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 141 PPPPPPPPPPAP 152 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 836 PXXPPPPPPPXPP 874 P PPPPPPP PP Sbjct: 1336 PSPPPPPPPPPPP 1348 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 836 PXXPPPPPPP 865 P PPPPPPP Sbjct: 1354 PVPPPPPPPP 1363 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 1390 PPPPPPLP 1397 >AF022981-6|AAY86319.1| 202|Caenorhabditis elegans Hypothetical protein W03F9.11 protein. Length = 202 Score = 27.1 bits (57), Expect(2) = 1.1 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +2 Query: 779 FXMTXTTSXXYXPXLFXNXPXXPPPPPPPXP 871 F + T P PPPPPPP P Sbjct: 102 FGLLQGTGEVIKPTTTTTTTTTPPPPPPPKP 132 Score = 22.6 bits (46), Expect(2) = 1.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPP P Sbjct: 125 PPPPPPKPSP 134 >AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical protein Y48G9A.4 protein. Length = 1115 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P L N PPPPPPP P Sbjct: 566 PPLPQNLSGAPPPPPPPPP 584 Score = 25.0 bits (52), Expect(2) = 1.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 830 NXPXXPPPPPP 862 N P PPPPPP Sbjct: 557 NVPIPPPPPPP 567 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 10/17 (58%), Positives = 10/17 (58%), Gaps = 4/17 (23%) Frame = +2 Query: 836 PXXPP----PPPPPXPP 874 P PP PPPPP PP Sbjct: 580 PPPPPMLGGPPPPPPPP 596 >Z50875-1|CAA90776.1| 1872|Caenorhabditis elegans Hypothetical protein T08A11.1 protein. Length = 1872 Score = 25.0 bits (52), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPP PP PP Sbjct: 819 PPPPLPPPPP 828 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N P PP PPPP Sbjct: 816 NPPPPPPLPPPP 827 >AL021180-3|CAA15982.1| 1872|Caenorhabditis elegans Hypothetical protein T08A11.1 protein. Length = 1872 Score = 25.0 bits (52), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPP PP PP Sbjct: 819 PPPPLPPPPP 828 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N P PP PPPP Sbjct: 816 NPPPPPPLPPPP 827 >AC025716-19|AAK39602.2| 549|Caenorhabditis elegans Hypothetical protein Y39G10AR.17 protein. Length = 549 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 772 PLLXXDXYNFXXIXTXPFPKXXXXXPPPPXPPPXP 876 P + Y++ + P+ PPPP PPP P Sbjct: 321 PPIQPPPYSYYPVAPAAAPQVYHYAPPPPPPPPHP 355 >Z19158-2|CAA79571.3| 262|Caenorhabditis elegans Hypothetical protein T23G5.3 protein. Length = 262 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP P Sbjct: 141 PPPPPPPPLP 150 Score = 23.8 bits (49), Expect(2) = 1.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXP 871 P + N PPPPPP P Sbjct: 130 PIVPRNLLLSKPPPPPPPP 148 >AL132860-5|CAB60515.1| 798|Caenorhabditis elegans Hypothetical protein Y56A3A.6 protein. Length = 798 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PPPPPP PP Sbjct: 748 NRPSSTPPPPPPPPP 762 >AF106580-3|AAC78205.1| 881|Caenorhabditis elegans Temporarily assigned gene nameprotein 268 protein. Length = 881 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 815 PXLFXNXPXXPPPPPPPXPP 874 P L PPPPPPP PP Sbjct: 74 PPLISILQQAPPPPPPPPPP 93 >Z69903-7|CAA93776.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPP PP P Sbjct: 110 PAFPPPPRPPKP 121 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 142 PPPPPVPP 149 >Z69660-1|CAA93489.1| 1607|Caenorhabditis elegans Hypothetical protein F39B1.1 protein. Length = 1607 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPP PP P Sbjct: 110 PAFPPPPRPPKP 121 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 142 PPPPPVPP 149 >AC024859-11|AAK29981.1| 933|Caenorhabditis elegans Hypothetical protein Y71H2AM.15a protein. Length = 933 Score = 25.4 bits (53), Expect(2) = 3.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 783 PSPLTAPIPPPPPPPPP 799 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 793 PPPPPPPMLP 802 >AC024859-10|ABA00158.1| 832|Caenorhabditis elegans Hypothetical protein Y71H2AM.15b protein. Length = 832 Score = 25.4 bits (53), Expect(2) = 3.8 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPPP PPP Sbjct: 682 PSPLTAPIPPPPPPPPP 698 Score = 22.2 bits (45), Expect(2) = 3.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PP P Sbjct: 692 PPPPPPPMLP 701 >Z81592-1|CAB04725.1| 695|Caenorhabditis elegans Hypothetical protein T16G1.1 protein. Length = 695 Score = 24.2 bits (50), Expect(2) = 3.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 830 NXPXXPPPPPPP 865 N PPPPPPP Sbjct: 529 NRRSGPPPPPPP 540 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 851 PPPPPXPP 874 PPPPP PP Sbjct: 534 PPPPPPPP 541 >Z82269-5|CAH60772.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 250 PPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 250 PPPPPPPPPPKP 261 >Z82269-4|CAB70200.2| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 265 PPPPPPPPPP 274 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 265 PPPPPPPPPPKP 276 >Z81135-1|CAB03453.1| 627|Caenorhabditis elegans Hypothetical protein W01G7.1 protein. Length = 627 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PP PPPP PP Sbjct: 510 NRPPLPPLPPPPPPP 524 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 515 PPLPPPPPPPKP 526 >Z12018-1|CAD88219.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 302 PPPPPPPPPP 311 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 303 PPPPPPPPPP 312 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 303 PPPPPPPPPPAP 314 >Z11126-8|CAD88221.2| 774|Caenorhabditis elegans Hypothetical protein ZK643.8 protein. Length = 774 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 302 PPPPPPPPPP 311 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 303 PPPPPPPPPP 312 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 303 PPPPPPPPPPAP 314 >U00058-3|AAD31933.1| 162|Caenorhabditis elegans Ground-like (grd related) protein22 protein. Length = 162 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 51 PPPPPPPPPP 60 >AY438643-1|AAR00670.1| 627|Caenorhabditis elegans abnormal DAuer Formation DAF-5,a Ski oncogene homolog involved in a neuronal TGF betapathway (71.0 kD) (daf-5) protein. Length = 627 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 830 NXPXXPPPPPPPXPP 874 N P PP PPPP PP Sbjct: 510 NRPPLPPLPPPPPPP 524 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 515 PPLPPPPPPPKP 526 >AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical protein Y40B1A.5 protein. Length = 134 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 22 PPPPPPPAPP 31 >AL032646-7|CAA21680.1| 485|Caenorhabditis elegans Hypothetical protein Y54E2A.8 protein. Length = 485 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 167 PPPPPPPVPP 176 >AL021487-15|CAH60766.1| 618|Caenorhabditis elegans Hypothetical protein Y45F10B.13b protein. Length = 618 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 250 PPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 250 PPPPPPPPPPKP 261 >AL021487-14|CAA16360.3| 633|Caenorhabditis elegans Hypothetical protein Y45F10B.13a protein. Length = 633 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 845 PPPPPPPXPP 874 PPPPPPP PP Sbjct: 265 PPPPPPPPPP 274 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 265 PPPPPPPPPPKP 276 >AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. Length = 468 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 238 PLPPVGAGAPPPPPPPPPP 256 >AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated protein 34, isoform b protein. Length = 310 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 224 PLPPVGAGAPPPPPPPPPP 242 >AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated protein 34, isoform a protein. Length = 454 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPPXP 876 P P PPPP PPP P Sbjct: 224 PLPPVGAGAPPPPPPPPPP 242 >AF078789-1|AAK21515.1| 392|Caenorhabditis elegans Hypothetical protein Y44E3B.2 protein. Length = 392 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 284 SPSSFCPKVPKTLPPPICLSQVTSRG-CR-LEDCPL 183 SP FC P PP C+S+V G CR ED P+ Sbjct: 321 SPYLFCYIPPNNEHPPSCVSKVRRNGVCRGFEDYPI 356 >AL117204-20|CAB55136.2| 699|Caenorhabditis elegans Hypothetical protein Y116A8C.32 protein. Length = 699 Score = 25.8 bits (54), Expect(2) = 6.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 674 PPPPPPPPMP 683 Score = 21.0 bits (42), Expect(2) = 6.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPP PPP Sbjct: 664 PPPGGLGGFMPPPPPPP 680 >AJ243905-1|CAB64866.1| 699|Caenorhabditis elegans SF1 protein protein. Length = 699 Score = 25.8 bits (54), Expect(2) = 6.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 847 PPPPXPPPXP 876 PPPP PPP P Sbjct: 674 PPPPPPPPMP 683 Score = 21.0 bits (42), Expect(2) = 6.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 820 PFPKXXXXXPPPPXPPP 870 P P PPP PPP Sbjct: 664 PPPGGLGGFMPPPPPPP 680 >Z93372-4|CAB07546.1| 301|Caenorhabditis elegans Hypothetical protein BE10.4 protein. Length = 301 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 824 FXNXPXXPPPPPP 862 + P PPPPPP Sbjct: 68 YPTGPPLPPPPPP 80 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 75 PPPPPPQP 82 >Z81543-3|CAB04425.1| 322|Caenorhabditis elegans Hypothetical protein F49B2.3 protein. Length = 322 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 261 PSQPPPPPPPPP 272 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 69 PICPPPPPPPMP 80 >AF039720-9|AAK68360.2| 676|Caenorhabditis elegans Hypothetical protein F33D11.9b protein. Length = 676 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = -3 Query: 295 LFQRVHHRFVPKCQRPCLPPFVCPK*RHEGVALRIAR*SSNLPRNQKVRKLL 140 LF V+ + +P V PK G+A+++ R S+LP+++ ++L+ Sbjct: 58 LFDPVNMEVTRISEHSLMPGLVTPKFDKSGIAIQLYRRFSDLPKSKSQQELI 109 >AC006638-2|AAK85481.1| 1256|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform a protein. Length = 1256 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 1009 PGGPPPPPPPPP 1020 >AC006638-1|AAK85482.1| 495|Caenorhabditis elegans Cyclase associated protein homologprotein 1, isoform b protein. Length = 495 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 836 PXXPPPPPPPXP 871 P PPPPPPP P Sbjct: 248 PGGPPPPPPPPP 259 >Z81129-3|CAB03404.1| 1262|Caenorhabditis elegans Hypothetical protein T23F1.5 protein. Length = 1262 Score = 23.4 bits (48), Expect(2) = 7.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 549 PPPPPPHP 556 Score = 23.0 bits (47), Expect(2) = 7.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 546 PYIPPPPPP 554 >AF026212-3|AAF99974.2| 1172|Caenorhabditis elegans Hypothetical protein F52G3.1 protein. Length = 1172 Score = 23.4 bits (48), Expect(2) = 7.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 848 PPPPPPXP 871 PPPPPP P Sbjct: 109 PPPPPPQP 116 Score = 23.0 bits (47), Expect(2) = 7.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 836 PXXPPPPPP 862 P PPPPPP Sbjct: 106 PAVPPPPPP 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,019,981 Number of Sequences: 27780 Number of extensions: 402487 Number of successful extensions: 5709 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3685 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2202903780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -