BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I10 (870 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 95 7e-20 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 91 1e-18 02_02_0470 - 10700092-10700505 30 2.8 10_08_0951 - 21769342-21769752 29 6.4 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 95.1 bits (226), Expect = 7e-20 Identities = 60/146 (41%), Positives = 83/146 (56%), Gaps = 5/146 (3%) Frame = +2 Query: 311 KNGGTRTVPLK----RRKSFYPTQE-KIRASSGGRPFSKHVRRIRPNLKIGTVCILLAGR 475 KNGGT K FYP + K RA S + + ++R + GTV ILLAGR Sbjct: 31 KNGGTFPKAGKPAAAAEPKFYPADDVKPRAPSTRKA---NPTKLRSTITPGTVLILLAGR 87 Query: 476 HAGKRVVLVGILPSGLLLVTXPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDY 655 + GKRVV + L SGLLL+T PF N P+RR+ Q YVI TST++ + K+ K F+D Y Sbjct: 88 YMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQAYVIATSTKVDISGVKVDK-FDDKY 146 Query: 656 FXKNXXCVKRTVKRKEXDDIFATKKE 733 F ++ K+ +K ++F T+KE Sbjct: 147 FARD----KKAKAKKTEGELFETEKE 168 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 90.6 bits (215), Expect = 1e-18 Identities = 55/138 (39%), Positives = 83/138 (60%), Gaps = 4/138 (2%) Frame = +2 Query: 362 PTQEKIRASSGGRPFS--KHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVT 535 PT+ + +SS FS + + +R ++ GTV ILLAGR GKRVV + L SGLLLVT Sbjct: 71 PTKLRSPSSSNLPEFSLFRFILLMRSSITPGTVLILLAGRFMGKRVVFLKQLKSGLLLVT 130 Query: 536 XPFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKHFNDDYFXKNXXCVKRTVKRKEXDDI 715 PF N P+RR+ Q YVI TST++ + + K F+D YF ++ K+ +K ++ Sbjct: 131 GPFKINGVPIRRVNQPYVIATSTKVDISGVNVEK-FDDKYFSRD----KKQKAKKTEGEL 185 Query: 716 FATKKE--KYVPSEQRQN 763 F T+KE K +P ++++ Sbjct: 186 FETEKEATKNLPEFKKED 203 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 437 LKIGTVCILLAGRHAGKRVVLVGILPSG 520 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 437 LKIGTVCILLAGRHAGKRVVLVGILPSG 520 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,633,907 Number of Sequences: 37544 Number of extensions: 463036 Number of successful extensions: 1001 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1000 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -