BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I07 (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 1e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 42 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 41 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.002 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.003 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 40 0.003 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.004 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 39 0.006 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.011 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 37 0.020 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 37 0.020 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.020 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 37 0.026 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 36 0.035 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 36 0.046 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 34 0.14 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 34 0.18 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 34 0.18 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 33 0.24 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.24 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.43 SB_11606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.56 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 32 0.56 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 0.74 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 32 0.74 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.74 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 32 0.74 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.74 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 32 0.74 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 31 0.98 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 31 0.98 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 1.3 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.3 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 31 1.7 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.7 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 2.3 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 2.3 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 2.3 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 2.3 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 30 2.3 SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) 25 2.6 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 25 2.7 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 30 3.0 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 30 3.0 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 3.0 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 4.0 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 29 4.0 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 29 4.0 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 29 4.0 SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 29 5.2 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 5.2 SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) 25 5.9 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 6.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 6.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 6.9 SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 6.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 6.9 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 28 9.2 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 28 9.2 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 9.2 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.2 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 28 9.2 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 28 9.2 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.2 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 28 9.2 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 28 9.2 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP L GG PPPPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPL------PGGAAPPPPP 693 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPPPPP + PPPPP GG PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPL-----PGGAAPPPP 692 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP P PPPP GG PPPPP Sbjct: 676 PPPPPPPLPGGAAPPPPPP-------IGGGAPPPPPP 705 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 713 PPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP + PPPP P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = +2 Query: 704 PPPPP------PPPXXXXXXFSXSPPPPPFXXF 784 PPPPP PPP + PPPP F F Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGF 710 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPP P PPPP GG PPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPP-----GDGGAPPPPPP 336 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 P PPPPP P PPPP GG PPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPP--------PGGAPPPPPP 319 Score = 37.1 bits (82), Expect = 0.020 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 316 PPPPPPPPPPGDGGAPPPPPP 336 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP + PPPPP Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPPP 337 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPP 336 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 700 SXPPPPPPPPXXXXXFFXFPPPPXFXXFFFXXGAXXPPP 816 S P PPPPPP PPPP GA PPP Sbjct: 300 SAPAPPPPPPPGGAPPPPPPPPPPPPG---DGGAPPPPP 335 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP + G PPPPP Sbjct: 363 PPPPPPPPVGG----PPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPX----PPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP P PPPP + GG PPPPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPP 367 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 705 PPPP-----PPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPP PPPP P PPPP R PPPP Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 705 PPPPP----PPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPP PPP P PPPP GG PPPPP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPP--------VGGPPPPPPP 380 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPP +PPPPP Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPPP 396 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXP 811 PPPPPP PPPPP GP P Sbjct: 375 PPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP FP PPPP Sbjct: 474 PPPPPPPPPPPPPPFPPPPPP 494 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPPPPP PPPPPF P PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPF--------PPPPPP 494 Score = 37.1 bits (82), Expect = 0.020 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP---------PPFPPPPP 493 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPPXXXKK 832 PPPPPPP PPPPP F+ P PPP +K Sbjct: 50 PPPPPPPRFYDNDIP--PPPPPRRGFYDDYPPPPPPPRRDEK 89 Score = 35.1 bits (77), Expect = 0.080 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP P P PPPP F PPPPP Sbjct: 50 PPPPPP-PRFYDNDIPPPPPP---RRGFYDDYPPPPPPP 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 8/47 (17%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXF--------SXSPPPPPFXXFFXXGGPXXPPP 817 L PPPPPP PPPPP F+ P PPP Sbjct: 23 LRPPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPP 69 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +1 Query: 715 PPPPPXXXXXFFXFPPPPXFXXFFFXXGAXXPPPXXKXKXS 837 PPPPP PPPP F+ PPP + + S Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPPRRDEKS 90 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPF 775 +PPPPPPPP + PPPPPF Sbjct: 194 MPPPPPPPPPPGFPGGAPPPPPPPF 218 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP PPPP F G PPPPP Sbjct: 195 PPPPPP---------PPPPG-----FPGGAPPPPPPP 217 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 758 PPPPPFXXFFXXGGPXXPPP 817 PPPPP F G P PPP Sbjct: 197 PPPPPPPPGFPGGAPPPPPP 216 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXS---PPPPPFXXFFXXGGPXXPPP 817 PPPPPPPP F+ S PPPPP F P PPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDF----APPPPPP 316 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PP P P PPPP F G PPPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPP 305 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 F PPPPPP P P PPPP Sbjct: 309 FAPPPPPPEP---TSELPPPPPP 328 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +2 Query: 704 PPPP----PPPPXXXXXXFSXSPPPPPF 775 PPPP PPPP PPPPPF Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPPF 330 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PP P P PPP +F G + PPPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP 306 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPP 767 PPPPPP P PPPP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP P PPPP PPPPP Sbjct: 301 PPPPPPTDFA---PPPPPP-------EPTSELPPPPP 327 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPP-----------PPPPPP 432 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXL 782 PPPPPPPP P PPPP L Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPPALRL 436 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP +PPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPP 424 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP + PPPPP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 + PPPPPPP PPPPP P PPP Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPP 425 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 400 PPPPPPPPPPPPP--PPPPPPA------PPPPPPPPPPP 430 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPPPPP PPPPP P PPP Sbjct: 398 PPPPPPPPPP-----PPPPPPPPPPPAPPPPPPPPPPP 430 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPP 763 PPPPPPPP + +PP Sbjct: 422 PPPPPPPPPPPALRLACAPP 441 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 420 PPPPPPPP----------PPPPP 432 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 +PPPPPP P S PPPPP G PPP Sbjct: 676 VPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPP 714 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPP 814 +PPPPPPPP PPPPP G P PP Sbjct: 693 VPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 +PPPPPPPP + PPPPP G P PPP Sbjct: 711 MPPPPPPPPPGC----AGLPPPPPSPQPGCAGLPPPPPP 745 Score = 35.1 bits (77), Expect = 0.080 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPP 767 PPPPPPP P PPPP Sbjct: 740 PPPPPPPPPGCAGLPPPPPP 759 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP P PPPPP G P PPP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPG---CAGLPPPPPP 759 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP P PPPPP P PPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPP 715 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 +PPPPPPPP S PPPPP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPP 1181 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPP PPPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.5 bits (73), Expect(2) = 0.011 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPP PPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPP P PPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPP 775 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 +PPPPPPP PPPPP Sbjct: 754 VPPPPPPPAVPGEGARPPPPPPPP 777 Score = 23.4 bits (48), Expect(2) = 0.011 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 704 PPPPPPPP 727 PPP PPPP Sbjct: 721 PPPAPPPP 728 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 37.5 bits (83), Expect = 0.015 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP S PPPPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.1 bits (82), Expect = 0.020 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXP 811 PPPPPPPP + PPPP G P P Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP +PPPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPP 710 Score = 35.1 bits (77), Expect = 0.080 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP PPPPP Sbjct: 683 PPPPPPPPPPPP---PPPPPP-------PQPSTPPPPPP 711 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP S PPPP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPP 709 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 +PPPPPPPP PPPPP P PPP Sbjct: 682 VPPPPPPPP---------PPPPPPPPPPPQPSTPPPPPP 711 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 37.5 bits (83), Expect = 0.015 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXL 773 PPPPPPPP P PPPP + Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVM 104 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 +PPPPPPPP +PPPPP Sbjct: 81 IPPPPPPPPPASNV---PAPPPPP 101 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 +PPPPP P F PPPPP P PPP Sbjct: 1234 MPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP 1272 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 37.1 bits (82), Expect = 0.020 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP +PPPPP Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPP 28 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 +PPPPPPPP + PPPP Sbjct: 4 VPPPPPPPPPIAAEFTAPPAPPPP 27 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPP P PP GG PPPPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSP--PPPPFXXFFXXGGPXXPPPXXXKK 832 PPPPPPP +P PPPP P PPP +K Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRK 997 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 P PPPP P PPPP GG P PPP Sbjct: 942 PSQPPPPGGNA---PPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 29.1 bits (62), Expect = 5.2 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +2 Query: 131 PPPXGXXKXKIXKXKPXXXXEPPXFFXGEKNXPXKNPRGKXDXPPGAXFPXKXGGGGGXP 310 PPP G +PP G P P G P G P GG P Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPP-GGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 311 FXXXXXGXPPPP*KK 355 PPPP +K Sbjct: 983 PPPPPPPPPPPPMRK 997 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 700 SXPPPPPPPPXXXXXFFXFPPPP 768 S PPPPPPPP PPPP Sbjct: 980 SAPPPPPPPPP--------PPPP 994 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 710 PPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP +PPPPP GGP PPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXK 830 PPPPPP P PPPP G PPPPP K Sbjct: 318 PPPPPP--SRDQVPLPPPP-------LRGQIAPPPPPISK 348 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 +PPPPPPP PPPPP GP PPP Sbjct: 1 MPPPPPPP----------GPPPPP----SAPSGPVKPPP 25 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 710 PPPPPPXXXXXXFSXSPPPPP 772 PPPPPP +PPPPP Sbjct: 371 PPPPPPGRRPPSGKINPPPPP 391 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 708 PPP----PPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPP PPPP PPPP G PPPPP Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPP P PPPP G PPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRP---PSGKINPPPPP 391 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPP + PPPPP Sbjct: 371 PPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPP PPP P PPP Sbjct: 5 PPPPGPPPPPSAPSGPVKPPP 25 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = +2 Query: 704 PPPP---PPPPXXXXXXFSXSPPPPPF----XXFFXXGGPXXPP 814 PPPP PPPP S +PPPPP F GP PP Sbjct: 263 PPPPKNAPPPPKRG----SSNPPPPPTRGPPSNSFTTQGPPLPP 302 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 708 PPPPPP---PXXXXXXFPXPPPPXLFXLFFXXG 797 PPPPPP P P PPPP + F G Sbjct: 371 PPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNG 403 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 37.1 bits (82), Expect = 0.020 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 710 PPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP +PPPPP GGP PPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 32.7 bits (71), Expect = 0.43 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXK 830 PPPPPP P PPPP G PPPPP K Sbjct: 230 PPPPPP--SRDQVPLPPPP-------LRGQIAPPPPPISK 260 Score = 31.5 bits (68), Expect = 0.98 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 710 PPPPPPXXXXXXFSXSPPPPP 772 PPPPPP +PPPPP Sbjct: 283 PPPPPPGRRPPSGKINPPPPP 303 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 708 PPP----PPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPP PPPP PPPP G PPPPP Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPP P PPPP G PPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRP---PSGKINPPPPP 303 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPP + PPPPP Sbjct: 283 PPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = +2 Query: 704 PPPP---PPPPXXXXXXFSXSPPPPPF----XXFFXXGGPXXPP 814 PPPP PPPP S +PPPPP F GP PP Sbjct: 175 PPPPKNAPPPPKRG----SSNPPPPPTRGPPSNSFTTQGPPLPP 214 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 708 PPPPPP---PXXXXXXFPXPPPPXLFXLFFXXG 797 PPPPPP P P PPPP + F G Sbjct: 283 PPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNG 315 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP + P PPP Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPR---PLAAKLPEPPP 250 Score = 35.1 bits (77), Expect = 0.080 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPPP P PPPP R PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPS------PSPPRPPPPPP 234 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPP PPPP PPPPP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPP 233 Score = 32.7 bits (71), Expect = 0.43 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PPPPPP PPPPP PPP Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PP PPPPP PPPPP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPP 234 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPP P PPP P Sbjct: 230 PPPPPPSPPRPLAAKLPEPPPIP 252 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPP 818 PPPPPP P PPPP + GG PPPP Sbjct: 138 PPPPPPIAPATGGPPPPPP----IAPATGGPPPPPP 169 Score = 35.1 bits (77), Expect = 0.080 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP + PPPP Sbjct: 197 PPPPPPPPPPPPPILELAAPPPP 219 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PPPPP PPPPP GGP PPP Sbjct: 124 PSPPPPPTSPATR--APPPPPPIAP--ATGGPPPPPP 156 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPP 818 PPPPPPPP P PPPP + L PPPP Sbjct: 195 PPPPPPPP-------PPPPPPPILEL------AAPPPP 219 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PPPPP + SPPPPP P PPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSP--ATRAPPPPPP 143 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 711 PPPPPPXXXXXXFPXPPPPXLFXLFFXX-GGRXPPPPP 821 PPPPPP P P P GG PPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP 201 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 7/43 (16%) Frame = +2 Query: 704 PPPP-------PPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXP 811 PPPP PPPP PPPPP P P Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVP 182 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 36.3 bits (80), Expect = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 663 PPPPPPPPGGGVPGPPKPPPP 683 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPP 769 PPPPPPP PPPP Sbjct: 663 PPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 714 PPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPP 818 PPPPP P PPPP G PPPP Sbjct: 653 PPPPPGGGMFPPPPPPPPG----GGVPGPPKPPPP 683 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.9 bits (79), Expect = 0.046 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +3 Query: 705 PPPPP---PPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPP PPP P PPPP G PPPPP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPP-------PTNGPPPPPPP 400 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPPPP + PPPPP GP PPP Sbjct: 374 PPPPPPPT------NGPPPPPP-----PTNGPPPPPP 399 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +2 Query: 704 PPPPPPP---PXXXXXXFSXSPPPPP 772 PPPPPPP P + PPPPP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +2 Query: 704 PPPPPPP----PXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PP PPPP P PPPPP GP PPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPP------TNGPPPPPP 389 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 704 PPPPPP---PPXXXXXXFSXSPPPPP 772 PPPPPP PP PPPPP Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 704 PPPPPP--PPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPP PP + PPPPP P PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPP------TNKPPPPPP 379 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGGGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 35.9 bits (79), Expect = 0.046 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGGGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 829 FXXGGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 + GG GG GGGG G GGGGGGGG Sbjct: 656 YGDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGG GG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 G GGG GGGG G GGGGGGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G G GG G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GG G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -2 Query: 817 GGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGG R + GGGG GGGGGGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRX--GGGGXGKXXXXXXGGGGGGG 707 GGGGG R GGGG G GGGGGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGG + GGGG G GGGGGGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 782 KXKKXGGGGXXKXXXXXXGGGGGGGG 705 K + GGGG + GGG GGGG Sbjct: 87 KTENRGGGGRRERGGRGGGGGYGGGG 112 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 G GGG GGGG G GGGGGGGG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGG G GGGGGGGG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGG G GGGG G GGGGGGGG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 829 FXXGGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 + GGG G GGGG G GGGGGGGG Sbjct: 830 YGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 32.7 bits (71), Expect = 0.43 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GG G G GGGGGGGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGGXXXXK 689 GGGG G GGGGGGGG K Sbjct: 854 GGGGGGGGGGGGGGGGGGGGGGGVIK 879 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGG 800 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 852 GGGGGGGGGGGGGGGGGGGGG 872 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 853 GGGGGGGGGGGGGGGGGGGGG 873 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 763 GGGXGKXXXXXXGGGGGGGG 704 GGG G GGGGGGGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGG 798 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GG GGGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGG 789 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGG G GGGGGGGG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGG 792 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGG 791 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 G GG G GGGGGGGG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGG 794 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGG 796 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 G GG G GGGGGGGG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGG 797 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 767 GGGGXXKXXXXXXGGGGGGGG 705 GGGG GGGGGGGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGG 799 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLF----XLFFXXGGRXPPPPP 821 PPPPPPPP P PPPP + PPPPP Sbjct: 102 PPPPPPPPPPPPP--PPPPPPITLHHEQHVVSHVMHPAPPPPP 142 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGG 707 GGGGG GGGG G GGGGGGG Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGG G GGGGGGGG Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGGG G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGG 82 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGG 83 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G G GGGGGG Sbjct: 63 GGGGGG---GGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 LPPPPPPPP PPPP Sbjct: 209 LPPPPPPPPEDDSIHNHEDLPPPP 232 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPP PPPPP Sbjct: 211 PPPPPPPEDDSIHNHEDLPPPPP 233 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 P PPPP P PPPP PPPPP Sbjct: 196 PTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPP 233 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPP PPPPP Sbjct: 212 PPPPPPEDDSIHNHEDLPPPPPP 234 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG R + GGG G GGG GGGG Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG R GG G G GGGG GGG Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -2 Query: 817 GGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGG R + GGGG G G GGGG G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG 187 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 829 FXXGGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 + GG GG GGGG G GGGG GGG Sbjct: 176 YGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PPPPP P P PP P + + PPPPP Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPP 818 PPPPPP P P PPPP GG PPPP Sbjct: 195 PPPPPPGPGG----IPPPPPP-------IRGGVPPPPP 221 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 + PPP PPPP P PPPP Sbjct: 161 YPPPPNPPPPNAPYPPPPYPPPP 183 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PP PPPPP P PPPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPP 120 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSP-PPPPFXXFFXXGGPXXPPP 817 PPPP PPP + P PPPP + P PPP Sbjct: 162 PPPPNPPP--PNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPP PP + PP PP+ P PPP Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PP PPP + PPPP + P PPP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 + PP PPPP P PPPP Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPP 178 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 706 PPPPPPPPXXXXXFFXFPPPP 768 PPP PPPP +PPPP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPP 183 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPP 767 PPPP PP P PPPP Sbjct: 180 PPPPNPPYPPPPNPPYPPPP 199 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 F P PP PPP P P PP + PPPP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 + PPP PP P P PPPP Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPP 170 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPP 818 + PPP PPPP P PP P PPPP Sbjct: 174 YPPPPYPPPPNPPYPPPPNPPYPP------PPNAPNPPPP 207 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPP-PPXLFXLFFXXGGRXP 809 PP PPPP +P PP P L G R P Sbjct: 220 PPYPPPPNAPNPPYPPPPNPQFAIALCLGHGPRSP 254 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 + PPP PP P +P PP P Sbjct: 108 YPPPPNPPYPPPPNAPYPPPPNP 130 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PP PP PP P PPPP Sbjct: 206 PPNPPYPPPPNAPNPPYPPPP 226 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 705 PPPPPPP--PXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPP 821 PP PPPP P P PPPP PPP P Sbjct: 114 PPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPP 815 + PPP P P +P PP P + PPP Sbjct: 132 YPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 867 PPPPPPPPPPPPP--PPPPPP 885 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPP 812 P PPPPP P PPPP GG P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 54 PPPPPPPPPPPP---PPPPPP 71 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPP 769 PPPPPPPP S SP P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.3 bits (60), Expect(2) = 0.43 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLF 776 PPPPP P PPP LF Sbjct: 928 PPPPPELLGSDADLPPPPPEVLF 950 Score = 23.8 bits (49), Expect(3) = 3.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 708 PPPPPPP 728 PPPPPPP Sbjct: 886 PPPPPPP 892 Score = 23.0 bits (47), Expect(2) = 0.43 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 699 FXPPPPPP 722 F PPPPPP Sbjct: 885 FPPPPPPP 892 Score = 21.4 bits (43), Expect(3) = 3.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 807 PPPPPXXKK 833 PPPPP KK Sbjct: 888 PPPPPVMKK 896 Score = 21.0 bits (42), Expect(3) = 3.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 705 PPPPPP 722 PPPPPP Sbjct: 849 PPPPPP 854 >SB_11606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 816 Score = 27.1 bits (57), Expect(2) = 0.56 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 800 APXXKKKXKKXGGGGXXKXXXXXXGGGGGGGG 705 AP +K K+ + GGGGGGGG Sbjct: 17 APYNLRKRKRSRSPAQRRRSRRGGGGGGGGGG 48 Score = 23.8 bits (49), Expect(2) = 0.56 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 728 GGGGGGGGXE 699 GGGGGGGG + Sbjct: 40 GGGGGGGGGD 49 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 32.3 bits (70), Expect = 0.56 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPP PPPP PPPPP Sbjct: 583 PPPHPPPPAHHVNKPGVPPPPPP 605 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 32.3 bits (70), Expect = 0.56 Identities = 22/66 (33%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = +2 Query: 194 PPXFFXGEKNXPXKNPRGKXDXPPGAXF-----PXKXGGGGGXPFXXXXXGXPPPP*KKK 358 PP G P +G PPGA P G GGG P G PPPP + Sbjct: 527 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQ 586 Query: 359 KXKXPP 376 + PP Sbjct: 587 EGPPPP 592 Score = 31.9 bits (69), Expect = 0.74 Identities = 27/95 (28%), Positives = 32/95 (33%), Gaps = 5/95 (5%) Frame = +2 Query: 242 RGKXDXPPGAXF-----PXKXGGGGGXPFXXXXXGXPPPP*KKKKXKXPPF*KXXXGGXX 406 +G PPGA P G GGG P G PP + PP GG Sbjct: 488 QGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGP 547 Query: 407 XXKXXGLVFKKXXXXXXRGGGXXPPXXFFFXXPPP 511 G + + +GGG PP PPP Sbjct: 548 PPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPP 582 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXL 773 PPPPPPPP P PPPP L Sbjct: 211 PPPPPPPP-------PPPPPPML 226 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGG 152 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGG 153 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGG 154 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGG 155 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGG 156 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGG 157 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGG 158 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGG 159 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGG 160 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGG 161 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGG 162 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGG 163 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 144 GGGGGGGGGGGGGGGGGGGGG 164 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 145 GGGGGGGGGGGGGGGGGGGGG 165 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 146 GGGGGGGGGGGGGGGGGGGGG 166 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG GGGG G GGGGGG G Sbjct: 133 GGGGGG---GGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 85 GGGGGGGGGVGGGGGGGGGGG 105 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G G GGGGGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGG 100 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGG 102 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 G GG G GGGGGGGG Sbjct: 83 GCGGGGGGGGGVGGGGGGGGG 103 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.9 bits (69), Expect = 0.74 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 714 PPPPPXXXXXXFPXPPPP 767 PPPPP FP PPPP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 LPPPPPPPP PPPPP Sbjct: 67 LPPPPPPPPPPL-------PPPPP 83 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 68 PPPPPPPPP------PLPPPP 82 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGG 73 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGG 74 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGG 75 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 57 GGGGGGGGGGGGGGGGGGGGG 77 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGG G Sbjct: 59 GGGGGGGGGGGGGGGGGGGDG 79 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.9 bits (69), Expect = 0.74 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFSXSPPPPP 772 LPPPPPPPP PPPPP Sbjct: 291 LPPPPPPPPPPL-------PPPPP 307 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 292 PPPPPPPPP------PLPPPP 306 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGGGG Sbjct: 97 GGGGFGGGGGGGFGGGGGGGG 117 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 817 GGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGG GGGG G G GGGGGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGG-GXGKXXXXXXGGGGGGG 707 GGGGG GGG G G GGGGGGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGG G GGGG G GGGG GGG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 79 PPPPPPPPP------PPPPPP 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 80 PPPPPPPP---------PPPPPP 93 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 31.5 bits (68), Expect = 0.98 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 280 PPPPPPPPP------PPPPPP 294 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 PPPPPPPP PPPPP Sbjct: 281 PPPPPPPP---------PPPPPP 294 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 31.5 bits (68), Expect = 0.98 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXLFXLFF 788 P P PPP P PPPP LF LF+ Sbjct: 169 PNPSPPPSGAP---PPPPPPPLFLLFY 192 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 707 PPPPPP------PXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPPPP P + +PPPPP P PPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPPXL 773 PPPPP P P PPPP L Sbjct: 303 PPPPPLPAGVPAPPPPPPPPML 324 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGG G GGGG GGGGGGG Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGG 311 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPP-----PXLFXLFFXXGGRXPPPPP 821 PPP PP P P PPP P + L PPPPP Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 9/47 (19%) Frame = +2 Query: 704 PPPPPPPPXXXXXX-------FSXSPPPPPFXXFFXXGG--PXXPPP 817 PPPPP PP S PPPPP F+ P PP Sbjct: 312 PPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPP 358 Score = 26.6 bits (56), Expect(2) = 1.3 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 716 PPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PP +PPP P F P PPP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPP 316 Score = 26.2 bits (55), Expect(2) = 8.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPP 814 PP PPP + PP PP F P PP Sbjct: 285 PPMTPPPAVV----TAPPPAPPLPNFTSPSPPPPPP 316 Score = 23.0 bits (47), Expect(2) = 1.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 704 PPPPPPPP 727 PPPPP PP Sbjct: 245 PPPPPVPP 252 Score = 20.6 bits (41), Expect(2) = 8.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 701 LPPPPPPPP 727 + PPPPP P Sbjct: 243 IKPPPPPVP 251 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPPPPPP P PPPP Sbjct: 1312 PPPPPPPP-------PPPPPP 1325 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPP 767 PPPPPPP P PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 700 SXPPPPPPPPXXXXXFFXFPPPP 768 S PPPPPPPP PPPP Sbjct: 1310 SPPPPPPPPPPP-------PPPP 1325 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPP--PPXLFXLFFXXGGRXPPPPP 821 PPPPPP P P PP P PPPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFF 787 PPPPPP P +P PPP F Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPPAPPHF 112 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 688 FXXXSXPPPPPPPPXXXXXFFXFPPPP 768 F S PPPPP PP PPPP Sbjct: 45 FISSSPPPPPPSPPAAAP---AAPPPP 68 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 PPPP P P P PPPP Sbjct: 685 PPPPLPTPIASSEPLPLPPPP 705 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGGGG G G G GGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDG 61 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPP 772 P P PPP F+ PPPPP Sbjct: 383 PLPTPPPMSTHPEFTSKPPPPP 404 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 815 GGGXXAPXXKKKXKKXGGGGXXKXXXXXXGGGGGGGG 705 GGG P + GGGG K GGG GGG Sbjct: 45 GGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 817 GGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGG 707 GGG P + R GGGG GGG GGG Sbjct: 45 GGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXKK 833 PPPP P P PPPP + R PP PP K+ Sbjct: 533 PPPPVPKPQFDDTPTRAPPPPDM-QTNPDTERRPPPLPPAPKR 574 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 772 RXGGGGXGKXXXXXXGGGGGGGG 704 R GGGG G GGG GGGG Sbjct: 97 RSGGGGYGGSSRGGYGGGRGGGG 119 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPPP 767 PPPPPPP P PPPP Sbjct: 424 PPPPPPPAPLPP--PPPPPP 441 Score = 28.3 bits (60), Expect = 9.2 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 701 LPPPPPPPP 727 LPPPPPPPP Sbjct: 433 LPPPPPPPP 441 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 814 GGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GGG R GG G G+ GG GGGGG Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGG 225 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 772 RXGGGGXGKXXXXXXGGGGGGGG 704 R GGGG G GGGG GGG Sbjct: 341 RGGGGGGGGGGGGGGGGGGRGGG 363 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGG 357 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGG GGGG Sbjct: 344 GGGGGGGGGGGGGGGGRGGGG 364 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GG GGGGG Sbjct: 345 GGGGGGGGGGGGGGGRGGGGG 365 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 772 RXGGGGXGKXXXXXXGGGGGGGG 704 R GGGG G GGG GGGG Sbjct: 102 RSGGGGYGGSSRGGYGGGRGGGG 124 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPP 764 PP PPPPP P PPP Sbjct: 791 PPTPPPPPRVMNGLPPSPPP 810 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPP 772 PP PPPP SPPP P Sbjct: 791 PPTPPPPPRVMNGLPPSPPPSP 812 >SB_25972| Best HMM Match : MIF4G (HMM E-Value=4.9e-40) Length = 1265 Score = 24.6 bits (51), Expect(2) = 2.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -1 Query: 758 GXXKXXXXXXGGGGGGGG 705 G K GGGGGGGG Sbjct: 705 GPPKSFNPRMGGGGGGGG 722 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 728 GGGGGGGGXE 699 GGGGGGGG + Sbjct: 716 GGGGGGGGVD 725 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 25.0 bits (52), Expect(2) = 2.7 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 700 SXPPPPPPP 726 S PPPPPPP Sbjct: 505 SNPPPPPPP 513 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 706 PPPPPPPP 729 P PPPPPP Sbjct: 536 PAPPPPPP 543 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 709 PPPPPPPXXXXXFFXFPPPP 768 PPPPPP FPPPP Sbjct: 1050 PPPPPPYQTGSPIRAFPPPP 1069 >SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) Length = 1552 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 P P PP P S SPPPPP Sbjct: 1223 PQPRPPTPIEVDGIDSPSPPPPP 1245 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 787 KKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 ++ +R GGGG G GGGGGGGG Sbjct: 507 RRPRRRRGGGGGG-----GGGGGGGGGG 529 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPP 767 + PPP PPPP P PPPP Sbjct: 160 YSPPPQPPPP-----PLPPPPPP 177 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 704 PPPP--PPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPPP P PP F+ PPP P PPP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPP 767 P PPPP P P PPPP Sbjct: 906 PAPPPPLPLAPEPPPPLPPPP 926 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 701 LPPPPPPPP--XXXXXXFSXSPPPP 769 LPPPPPPP F SPP P Sbjct: 1113 LPPPPPPPTEIPPAQETFEGSPPCP 1137 Score = 25.4 bits (53), Expect(2) = 3.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 P PPPP + PPPP P PPP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPL-----PPPPPP 981 Score = 22.6 bits (46), Expect(2) = 3.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 701 LPPPPPP 721 LPPPPPP Sbjct: 922 LPPPPPP 928 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGG 800 PPPPPPPP P P P + + GG Sbjct: 142 PPPPPPPPSPPPPCHP-PALPSTYRWYNQWGG 172 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGG GG Sbjct: 90 GGGGDGDGGGGGDGGGGGDGG 110 >SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) Length = 398 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 709 PPPPPPPXXXXXFFXFPPPP 768 PPPP PP F PPPP Sbjct: 360 PPPPLPPGDGYEFQGVPPPP 379 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGG 707 GGGG G GGGGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 763 GGGXGKXXXXXXGGGGGGGG 704 GGG G GGGGGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 763 GGGXGKXXXXXXGGGGGGGG 704 GGG G GGGGGGGG Sbjct: 30 GGGHGYGGGPNGGGGGGGGG 49 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 31 GGHGYGGGPNGGGGGGGGGGG 51 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -2 Query: 772 RXGGGGXGKXXXXXXG--GGGGGGG 704 R GGGG G G GGGGGGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGG 47 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGG GG Sbjct: 105 GGGGDGDGGGGGDGGGGGDGG 125 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +3 Query: 705 PPPP----PPPPXXXXXXFPXPPPP 767 PPPP PPPP P PPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 699 FXPPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXKK 833 + P PPPP P PPPP PPPPP KK Sbjct: 220 YLEPTPPPPAA------PAPPPPP------AAAPPPPPPPPPVKK 252 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXP 758 PPPPPPPP P P Sbjct: 796 PPPPPPPPPPEDLIIPLP 813 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXKK 833 PPPPPPPP P PP + L PP KK Sbjct: 794 PPPPPPPP-------PPPPEDLIIPLPRRGSDLFAPPADKGKK 829 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGG GGG Sbjct: 5 GGGGDGDGGDGDGGGGGDGGG 25 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGG GGGG Sbjct: 154 GGGGRGGGRGHGRGGGSGGGG 174 >SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2149 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 709 PPPPPPPXXXXXFFXFPPPP 768 PPPP PP F PPPP Sbjct: 2111 PPPPLPPGDGYEFQGVPPPP 2130 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXLFXLFFXXGGRXPPPPPXXKK 833 PPPPPPP P P G R PPPP K Sbjct: 777 PPPPPPPTKPATPRVPPNIPSR------PPGARPTPPPPPPGK 813 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 G GG G GGGGGGGG Sbjct: 306 GDGGGGGDGGGGGGGGGGGGG 326 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGGG GG Sbjct: 309 GGGGDGGGGGGGGGGGGGDGG 329 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GG GG GGG G G GGGGGG Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 704 PPPPPP--PPXXXXXXFSXSPPPPP 772 PPPPPP PP SPPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 >SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) Length = 659 Score = 25.0 bits (52), Expect(2) = 5.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 712 PPPPPPXXXXXFFXFPPPPXF 774 PPPPPP F P P F Sbjct: 103 PPPPPPMISNDFTLNPNPVTF 123 Score = 22.2 bits (45), Expect(2) = 5.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 700 SXPPPPPP 723 S PPPPPP Sbjct: 101 SDPPPPPP 108 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 829 FXXGGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 F GG GG + GG G G GGGGGGGG Sbjct: 452 FLAGGAGGRSNQNDVE-----GGFGGGGGPNGAGGGGGGGGG 488 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 701 LPPPPPPPPXXXXXXFS 751 LPPPPPPPP +S Sbjct: 726 LPPPPPPPPQTTPFGYS 742 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +2 Query: 704 PP--PPPPPPXXXXXXFSXSPPPPP 772 PP PPP PP PPPPP Sbjct: 276 PPGMPPPMPPGGMPPNMEQPPPPPP 300 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSPPPPPFXXF-FXXGGPXXPP 814 P PP PP +PP PP G P PP Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPP 772 P PPPPPP PPPPP Sbjct: 573 PKPPPPPPEPP----EECPPPPP 591 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 708 PPPPPPPXXXXXXFPXPPP 764 P PPPPP P PPP Sbjct: 573 PKPPPPPPEPPEECPPPPP 591 >SB_21275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.7 bits (61), Expect = 6.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 700 SXPPPPPPPPXXXXXFFXFP 759 S PPPPPPPP F P Sbjct: 185 SMPPPPPPPPPRFVPFTTGP 204 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPP PP PPPPP G P PPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPP----PGAGDPAYPPP 242 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 704 PPPPPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXP 811 PPP PPP + PP PP G P P Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 25.8 bits (54), Expect(2) = 7.5 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 704 PPPPPPPPXXXXXX---FSXSPPPPP 772 PPPPPPP + + PPPP Sbjct: 888 PPPPPPPATSNGDPSLLLTTNVPPPP 913 Score = 21.0 bits (42), Expect(2) = 7.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 701 LPPPPPPPP 727 LPP PP PP Sbjct: 858 LPPCPPDPP 866 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 772 RXGGGGXGKXXXXXXGGGGGGG 707 R GGGG G GG GGGG Sbjct: 189 RSGGGGYGGSKGGYGGGSGGGG 210 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 6.9 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +3 Query: 699 FXPPPPPPPP 728 F PPPPPPPP Sbjct: 376 FAPPPPPPPP 385 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 226 GGFGGGGGVWGNGGGGGGGGG 246 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 G GGG P + R GGGG G GG G GG Sbjct: 194 GRGGGRGAPRG-RGGPRGGGGGSGGYGGGSYGGYGNYGG 231 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GG G G GGGGGGGG Sbjct: 487 GGFGGGGGASGGGGGGGGGGG 507 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +2 Query: 704 PPP--PPPPPXXXXXXFSXSPPPPPFXXFFXXGGPXXPPP 817 PPP P PPP P P F P PPP Sbjct: 948 PPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPP 987 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 705 PPPPPPPPXXXXXXFPXPPPPXL 773 PPPPPPPP P P + Sbjct: 458 PPPPPPPPQMYQQPLMMPQAPMM 480 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 764 GGGXXKXXXXXXGGGGGGGG 705 GGG + GGGGGGGG Sbjct: 153 GGGGRRGGGGCCGGGGGGGG 172 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSP------PPPPFXXFFXXGGPXXPPP 817 P P PPP + P PPPP F P PPP Sbjct: 75 PYPGPPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSPPP 117 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -2 Query: 817 GGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGG 704 GG G R + GGGG G GGG GGG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGG 786 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 28.3 bits (60), Expect = 9.2 Identities = 20/74 (27%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = +2 Query: 128 HPPPXGXXKXKIXKXKPXXXXEPPXFFXGEKNX--PXKNPRGKXDXPPGAXFPXKXGGGG 301 +PPP G + P PP + E P +P PP + GG Sbjct: 190 YPPPGGYQQP------PPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYP 243 Query: 302 GXPFXXXXXGXPPP 343 G P G PPP Sbjct: 244 GAPPAGGYPGAPPP 257 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 764 GGGXXKXXXXXXGGGGGGGG 705 GGG + GGGGGGGG Sbjct: 70 GGGGRRGGGGCCGGGGGGGG 89 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 766 GGGGXGKXXXXXXGGGGGGGG 704 GGGG G GGGG GGG Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGG 1783 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 820 GGGGGXRPPXXKKXXKRXGGGGXGKXXXXXXGGGGGGGGXXXXK 689 GGGGG + GG G G G GGGGGG K Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMGAG---GEGGGAGGGGGGYSAQK 1851 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +2 Query: 707 PPPPPPPXXXXXXFSXSP------PPPPFXXFFXXGGPXXPPP 817 P P PPP + P PPPP F P PPP Sbjct: 165 PYPGPPPVLSPQVYRCYPFQYPGTPPPPMYPAFPPSFPFSPPP 207 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 764 GGGXXKXXXXXXGGGGGGGG 705 GGG + GGGGGGGG Sbjct: 153 GGGGRRGGGGCCGGGGGGGG 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,544,274 Number of Sequences: 59808 Number of extensions: 438474 Number of successful extensions: 9817 Number of sequences better than 10.0: 112 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3078 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -