BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I06 (842 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24440.1 68416.m03067 fibronectin type III domain-containing ... 34 0.14 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 33 0.31 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 33 0.31 At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 31 1.3 At5g27230.1 68418.m03248 expressed protein ; expression support... 30 2.2 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 28 6.8 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 28 8.9 >At3g24440.1 68416.m03067 fibronectin type III domain-containing protein contains Pfam profile PF00041: Fibronectin type III domain Length = 602 Score = 33.9 bits (74), Expect = 0.14 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = +2 Query: 80 CLDSGWACSRRAQQCSTKTEHHKVKKCGCRIC*KAKENS--VLLPRCEPTK 226 CL S W C + + + E K+C C +C EN L CEP K Sbjct: 42 CLRSSWICKNASCRANVPKEDSFCKRCSCCVCHNFDENKDPSLWLVCEPEK 92 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 32.7 bits (71), Expect = 0.31 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -3 Query: 582 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGTLVERFKVLS 424 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 32.7 bits (71), Expect = 0.31 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = -3 Query: 582 KHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGTLVERFKVLS 424 K R + R + + AL N+DVE +E+ L+E T G ER+ VLS Sbjct: 828 KMLREFSKRKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 300 KAVEEFLKMYRTGFMPKNLEFSVFL 374 KA+E F +MY+TG MP + +S L Sbjct: 239 KAIEWFERMYKTGLMPDEVTYSAIL 263 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +3 Query: 147 KSKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLK 323 +S V A+ +EK++K L D S E+ K KD+D+E + K+ VE+ K Sbjct: 65 ESIKVKALELEKKEKELCLI-DESMKAKQSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 225 NTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFL 320 N +DEY K DYD + +D T K+A + L Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDIL 573 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +3 Query: 177 EKQKKILSFFQD--VSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPK 350 EK +K+L+ Q + QL D+ K+G Y E +DN ++ + + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 351 NLEFSVF 371 LEF +F Sbjct: 142 ALEFRLF 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,028,138 Number of Sequences: 28952 Number of extensions: 310647 Number of successful extensions: 772 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1950880000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -