BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I04 (871 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0725 - 20442988-20443180,20443268-20443540,20443642-204438... 32 0.52 06_01_0580 + 4148969-4149101,4149394-4149546,4149682-4150095,415... 31 0.91 02_05_0314 + 27818077-27818809,27818839-27818906,27819345-278195... 30 2.1 08_01_1027 - 10373760-10373837,10373918-10374201,10374286-10374394 28 8.5 08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944,287... 28 8.5 04_04_1173 + 31469357-31469920 28 8.5 >08_02_0725 - 20442988-20443180,20443268-20443540,20443642-20443853, 20443935-20444247,20444334-20444441,20444537-20444643, 20444743-20444781 Length = 414 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = -1 Query: 313 TTFTKKSLVALSQSPEDLPSPHFLVPSDKVV 221 TTF +++ A S +PE+LP P ++ D+VV Sbjct: 233 TTFRRRTTAAASPAPEELPLPRKILDHDRVV 263 >06_01_0580 + 4148969-4149101,4149394-4149546,4149682-4150095, 4150218-4150294,4151479-4152699,4153057-4153128 Length = 689 Score = 31.5 bits (68), Expect = 0.91 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 49 SVSSSETVTIQNVFQGCCYPAALLVCVNAQVSMPPGLR 162 S++++ + T+Q V P LL C A+VSMPP +R Sbjct: 394 SLTNTLSSTLQRVPSSSLPPQELLECKQAKVSMPPSIR 431 >02_05_0314 + 27818077-27818809,27818839-27818906,27819345-27819528, 27819700-27819800,27820479-27820586,27820728-27820946 Length = 470 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +3 Query: 489 SKHQLPACGILVRTLTC--QPAEWSLXSSVTEGLMSVYRPXLLTSGNCQHPLSXQLYKC 659 S P G+ +R L+C Q ++W +S + Y P + C HPLS + C Sbjct: 24 SLQSCPYFGVPLRWLSCTEQTSKWETSTSYQIDDVDQYSPISSVAKICTHPLSSHVNHC 82 >08_01_1027 - 10373760-10373837,10373918-10374201,10374286-10374394 Length = 156 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 516 ILVRTLTCQPAEWSLXSSVTEGLMSVYRPXLLTSGNCQHP 635 I+ R L + EW L S V +M P L SGN + P Sbjct: 82 IMERILREEAEEWELESEVRREIMEHIFPLLRRSGNARPP 121 >08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944, 2875909-2875947,2876309-2876354,2877380-2877922, 2878827-2880847,2880972-2881215,2881642-2881684, 2881923-2881962,2883580-2883675,2883712-2883759, 2883964-2884290 Length = 1498 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 100 CYPAALLVCVNAQVSMPPGLRREVSDHQPIFKVSLTP 210 CY + L C++A +SMP G + S + F+ + P Sbjct: 290 CYKSTSLSCLSAVLSMPVGSLTQSSSNPLTFEACIAP 326 >04_04_1173 + 31469357-31469920 Length = 187 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 124 CVNAQVSMPPGLRREVSDHQPIFKVSLTPSRYSRLCHLG-QGNGGREG 264 C + ++ +PP R S +F S++ SR+ H G +G+ G EG Sbjct: 43 CASRRLGLPPTTRSFASPSLVLFDTSVSRSRHRCPPHRGARGDAGSEG 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,084,734 Number of Sequences: 37544 Number of extensions: 396964 Number of successful extensions: 955 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -