BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I04 (871 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) 29 3.7 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 156 ARRHRNLSVHAYKECSGITTALEYILNCDSFAARDR 49 A+R RNLS A KEC + L + N S A +++ Sbjct: 1748 AQRRRNLSFEADKECEMLKEELHQLKNAQSMAEQEK 1783 >SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) Length = 725 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 159 TQRSIRSPANFQSQSDTLAIFTTLSLGTRKWGEGRSSGLWERATXDFLVKVV 314 T+ + +PA ++ TTL+L + RSSG + A+ FL K+V Sbjct: 434 TRSATYAPAIMSGCGTSIMFVTTLALAAELVDQDRSSGAFVMASMSFLSKIV 485 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,812,298 Number of Sequences: 59808 Number of extensions: 445470 Number of successful extensions: 812 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -