BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I04 (871 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 24 5.2 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 9.2 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 24.2 bits (50), Expect = 5.2 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -1 Query: 664 KXHLYSXFDNGCWQLPLVSNXGL*TDIXPSVTELXRDHSAG*QVSVLTKI-PHAG 503 K H N W L L + + P+V +H+AG V L +I PH G Sbjct: 69 KHHCGGSILNSKWILTAAHCIDLYSQVKPTVRVGSSEHAAGGTVLHLVRIVPHPG 123 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +2 Query: 305 KGGYNRXFFNDDRGKLTGQAYGTRVLGPXGDSTSYGG 415 +G N F D+ + GQ T P G ++GG Sbjct: 2 EGRDNNGFIGDNSPSIAGQYRWTTPAAPNGVHVTHGG 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,175 Number of Sequences: 2352 Number of extensions: 13924 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -