BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I03 (834 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.41 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.41 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 32 0.54 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 2.2 At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00... 29 3.8 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 6.6 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 6.6 At3g61680.1 68416.m06912 lipase class 3 family protein contains ... 28 6.6 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 32.3 bits (70), Expect = 0.41 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 146 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 313 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 343 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 32.3 bits (70), Expect = 0.41 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +2 Query: 146 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRR 313 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLR 344 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 31.9 bits (69), Expect = 0.54 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 293 LIIDKRRNTMEYCYKLWVGNGQEIVRKYFPLNF 391 +++D + EY KL + +G + KYFPL F Sbjct: 386 IVVDTKNLNCEYQLKLMIASGVDAANKYFPLAF 418 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 119 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 220 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box only protein 7 (SP:Q9Y3I1) {Homo sapiens} ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 350 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -1 Query: 168 LEVSADSSTTPALAASMHIANTTRSFILLGAFQDRLQVCK---SKILRIPYSELVIK 7 LE S D+S ALA S+H F+LL D+ K S LR EL+ + Sbjct: 54 LEKSGDTSDLTALALSVHAVMLESGFVLLDHGSDKFSFSKKLLSVSLRYTLPELITR 110 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 185 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 301 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 185 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 301 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At3g61680.1 68416.m06912 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 649 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 629 NCNSRDRVVYGGNSADSTREQWFFQPAKYEN-DVLV 733 N +R V+ G +S S + FF+P K+E+ DVLV Sbjct: 349 NTYTRCFVIQGSDSLASWKANLFFEPTKFEDTDVLV 384 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,865,122 Number of Sequences: 28952 Number of extensions: 339840 Number of successful extensions: 915 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1921616800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -