SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_I02
         (839 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U77974-1|AAB36556.1|  276|Tribolium castaneum transcription fact...    24   1.7  

>U77974-1|AAB36556.1|  276|Tribolium castaneum transcription factor
           homolog protein.
          Length = 276

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 13/41 (31%), Positives = 18/41 (43%)
 Frame = +1

Query: 106 APAAAATKLKPDEDPLGIRAVLLGPPGSGKGTQAPRLKEKY 228
           +P  +   L P  +PL I    L   G  K  Q P+L + Y
Sbjct: 232 SPVQSDVSLSPVHEPLLITTEKLAAEGQTKLPQQPKLFKPY 272


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,347
Number of Sequences: 336
Number of extensions: 3678
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23140487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -