BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP03_F_I02
(839 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 24 1.7
>U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor
homolog protein.
Length = 276
Score = 23.8 bits (49), Expect = 1.7
Identities = 13/41 (31%), Positives = 18/41 (43%)
Frame = +1
Query: 106 APAAAATKLKPDEDPLGIRAVLLGPPGSGKGTQAPRLKEKY 228
+P + L P +PL I L G K Q P+L + Y
Sbjct: 232 SPVQSDVSLSPVHEPLLITTEKLAAEGQTKLPQQPKLFKPY 272
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,347
Number of Sequences: 336
Number of extensions: 3678
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23140487
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -