BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I01 (818 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1091 + 24256025-24256190,24256806-24257978,24258066-242587... 28 7.8 >08_02_1091 + 24256025-24256190,24256806-24257978,24258066-24258733, 24258994-24260065,24260241-24260563,24260647-24260835, 24261400-24261506,24262103-24262163,24262617-24262634 Length = 1258 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +2 Query: 176 ADAERKKACMHDCTKANLDPICAGKTGEKPKSFGNECVMNNYNCEHKDTLRKISQ 340 +D + ++AC +C+ L C +P S G+ + N NC D ++ Q Sbjct: 724 SDQQSQQACASNCSNKELGEKCIHDDPGQPVSDGHIPLQNGDNCADFDETVEVHQ 778 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,049,805 Number of Sequences: 37544 Number of extensions: 309810 Number of successful extensions: 967 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -