BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H24 (954 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 1e-25 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.4 SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 2.4 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 30 2.4 SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) 30 2.4 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 30 3.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 3.2 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 30 3.2 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 4.2 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 5.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 5.5 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 29 7.3 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 28 9.7 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 28 9.7 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 28 9.7 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 114 bits (274), Expect = 1e-25 Identities = 53/70 (75%), Positives = 61/70 (87%), Gaps = 2/70 (2%) Frame = +3 Query: 237 RNVRSLEKV--CADLINGAKKQKLRVKGPVRMPTKILRITTRKTPCGEGSXTCDRFQMRI 410 + VR+ KV CADLI GAK++KL+VKGPVRMPTK LRITTRKTPCGEGS T DR++MRI Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRI 65 Query: 411 HKRVIDLHSP 440 HKR+IDLHSP Sbjct: 66 HKRLIDLHSP 75 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 439 PSEIVKQITSINIXP 483 PSEIVKQITSI+I P Sbjct: 75 PSEIVKQITSISIEP 89 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP PP P PP FP Sbjct: 470 PPPPPPPPPPPPPPPPPPFP 489 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFPXY*P 632 PPPP PP P PP P + P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFPXY 626 PPPP PP P PP P + Sbjct: 477 PPPPPPPPPPPFPPPPPPTPLH 498 >SB_50663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +2 Query: 206 YSPHQDHSYFSQCALTR---EGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 355 Y P +SY + CA T+ +G + A+ + PH N DPA+ P Sbjct: 267 YDPQNPYSYGAYCAYTQAQPQGFNAQAYPYENNSASARPAMPHYNSDPAHTEP 319 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFPXY*PXXLAXPT 653 PPPP SPP SP PP P P A PT Sbjct: 31 PPPP----SPPPSPPPPSPPLDCPCLTAYPT 57 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFPXY*PXXLAXPT 653 PPPP SPP SP PP P P A PT Sbjct: 154 PPPP----SPPPSPPPPSPPLDCPCLTAYPT 180 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/66 (27%), Positives = 26/66 (39%) Frame = -1 Query: 666 GMVXRWGXPGXXVSXRGNXGGXGTGXGMRXGXGGGVXGXSXDILMGGXAXASXMVTSTFT 487 GM+ G +S G G G G GM G GG+ G + + G + M+ Sbjct: 159 GMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMG 218 Query: 486 PGLDVN 469 G+ N Sbjct: 219 GGMGFN 224 >SB_35369| Best HMM Match : Helicase_C (HMM E-Value=6.1e-05) Length = 584 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 236 SQCALTREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 355 S C GLC P + ++ + GPSP + DP+ P Sbjct: 412 SICLCAPSGLCVPIHFLPNSDPSLAGPSPSSKLDPSIRDP 451 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 171 KDIEKPQAEVSPIHRIRITLTSRNVRSLEKVCAD 272 + + K Q E + IH + +T ++VRSLE+ C + Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRCLE 696 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -1 Query: 702 NSKGGXXXKXNQGMVXRWGXPGXXVSXRGNXGGXGTGXGMRXGXGGG 562 N +GG +QG R G G S RG GG G G G GGG Sbjct: 180 NERGGGG---SQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 223 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -1 Query: 705 ANSKGGXXXKXNQGMVXRWGXPGXXVSXRGNXGGXGTGXGMRXGXGGG 562 A +G +QG R G G S RG GG G G G GGG Sbjct: 85 AQPRGERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 132 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP S PP P PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSP 389 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P SPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPP 392 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP PP SP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPP 384 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP SPP P PP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPP 399 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P +PPPP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPP 423 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPP 425 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPP 611 PPPP SPP P PP Sbjct: 369 PPPPPPPPSPPPPPPPP 385 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 859 PXXXXPFFXXXPPXXXXPXPPXXPXSXSPPPP 954 P P PP P PP P PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 504 PSPTXXXXRPLKYXLTXRXPPPPXXXSSPPXSPXPPXFP 620 PSP P PPPP PP P PP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 859 PXXXXPFFXXXPPXXXXPXPPXXPXSXSPPPP 954 P P PP P PP P PPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFPXY*PXXLAXPTX*PXL 668 PPPP PP P PP P P P P L Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 546 LTXRXPPPPXXXSSPPXSPXPP 611 +T PPPP SPP P PP Sbjct: 201 ITQPPPPPPRPPPSPPPPPPPP 222 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPP 611 PPPP SPP P PP Sbjct: 217 PPPPPPSPSPPRPPPPP 233 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 598 PPXPPI-SPXTDXXXWPPPPXNHXLIXFGXTPP 693 PP PPI P T PPPP G PP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 373 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 598 PPXPPI-SPXTDXXXWPPPPXNHXLIXFGXTPP 693 PP PPI P T PPPP G PP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 285 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 895 PXXXXPXPPXXPXSXSPPPP 954 P P PP P S SPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPP 1176 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP PP SP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP 1177 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP SPP P PP P Sbjct: 1164 PPPPPSSPSPPPPPPPPPPP 1183 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP S PP P PP P Sbjct: 1165 PPPPSSPSPPPPPPPPPPPP 1184 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P +PPPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPP 709 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPP 711 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 661 GYXVGXARXXGQ*XGKXGGXGDXGGDEXXXGGGGXRXVK 545 GY G G G GG G GG GGGG +K Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPP 245 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 880 FXXXPPXXXXPXPPXXPXSXSPPPP 954 F PP P PP P PPPP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPP 112 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPP 388 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPP 398 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P + PPPP Sbjct: 388 PPPTNGPPPPPPPTNGPPPPP 408 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +3 Query: 504 PSPTXXXXRPLKYXLTXRXPPPPXXXSSPPXSPXPPXFPXY*PXXLAXPTX*P 662 P P P T PPPP + PP P P P P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 555 RXPPPPXXXSSPPXSPXPPXFP 620 R PPPP SPP PP P Sbjct: 140 RNPPPPPPPPSPPPPCHPPALP 161 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 892 PPXXXXPXPPXXPXSXSPPPP 954 PP P PP P PPPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPP 215 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPP 611 PPPP S PP P PP Sbjct: 237 PPPPPYTSLPPDDPPPP 253 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 561 PPPPXXXSSPPXSPXPPXFP 620 PPPP +PP P PP P Sbjct: 305 PPPPPPGGAPPPPPPPPPPP 324 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 507 SPTXXXXRPLKYX-LTXRXPP-PPXXXSSPPX-SPXPPXFP 620 SP P++Y L R PP PP SS P P PP +P Sbjct: 316 SPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYP 356 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,165,415 Number of Sequences: 59808 Number of extensions: 461439 Number of successful extensions: 2424 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2035 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2800542235 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -