BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H22 (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C su... 44 2e-04 At3g52110.1 68416.m05719 expressed protein 29 4.0 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 9.2 At3g50190.1 68416.m05488 expressed protein contains Pfam profile... 28 9.2 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 28 9.2 At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / th... 28 9.2 >At2g07671.1 68415.m00894 H+-transporting two-sector ATPase, C subunit family protein similar to ATPase subunit 9 [Arabidopsis thaliana] GI:15215920; contains Pfam profile PF00137: ATP synthase subunit C Length = 85 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = +1 Query: 379 FGSLIIGYARNPSLKQQLFSYAILGFALSE 468 F SLI ARNPSL +Q F YAILGFAL+E Sbjct: 39 FSSLIHSVARNPSLAKQSFGYAILGFALTE 68 >At3g52110.1 68416.m05719 expressed protein Length = 362 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -3 Query: 199 VAPVQSCRRWQTWLQGRSVWRQTAFCFYKVRRATTKNTEKEETGLWNVQ---FLSQILRI 29 V ++S + + GR ++ + Y+++R T+ TE+E+TG V+ + +I+ Sbjct: 136 VPRLKSTQSARNLFSGRDIFGHISDFCYELKRLATRVTEREDTGKSEVKESHQVGEIVNQ 195 Query: 28 PYS 20 PYS Sbjct: 196 PYS 198 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 113 LIKTKCCLPPD*SPLQPGLPSSATLH--WCDHLQQYPPI 223 L++ CC + P LPS LH +C LQ +P I Sbjct: 682 LLEMSCCKKLEIIPTNINLPSLEVLHFRYCTRLQTFPEI 720 >At3g50190.1 68416.m05488 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 463 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -3 Query: 178 RRWQTWLQGRSVWRQTAF--CFYKVRRATTKNTEKEETGLWNVQFLSQILRIP 26 RRW +W + RQ C ++R A K ++ LW++QF + L IP Sbjct: 292 RRW-SWKPVVADKRQQKLLHCVTELREAGIKFKRRKSDRLWDIQFKNGCLEIP 343 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 317 NLAAESMSLVTDVVWKDRTAESCVGTAGTICVWVGTAASGRTS 189 N+A+E + L+ ++ CV +C+ VG ++SG+TS Sbjct: 2028 NIASEQLKLLPEIRQNLEAVAHCVQNKW-LCILVGPSSSGKTS 2069 >At1g17960.1 68414.m02222 threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative similar to SP|O04630 Threonyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) {Arabidopsis thaliana}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain, PF02824: TGS domain Length = 458 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 272 SRPHRSLRTLTLLPNSLVLVQRQWE*LVPELVLEQSSAPSSSAM 403 SRPH ++ +TLLP+ + R+WE ++ ++ S + SA+ Sbjct: 37 SRPHDPIK-ITLLPDGIEKEGRRWETSPMDIAVQISKGLAKSAL 79 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,543,711 Number of Sequences: 28952 Number of extensions: 369387 Number of successful extensions: 1096 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -