BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H21 (869 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1250 + 32077590-32078000,32078132-32078308,32078437-320785... 71 2e-12 10_06_0110 + 10889414-10889669,10889756-10889806,10890595-108911... 30 2.1 12_02_0515 - 19920411-19921694 29 3.7 11_03_0068 + 9564354-9565180,9566658-9568704 29 3.7 03_06_0568 - 34778408-34778710,34779340-34779411,34779549-347796... 29 6.4 >04_04_1250 + 32077590-32078000,32078132-32078308,32078437-32078561, 32078629-32078761,32078866-32079015,32079105-32079158, 32079437-32079532,32080021-32080095,32080723-32080824, 32080903-32081589,32081686-32081817,32081916-32082023, 32082170-32082319 Length = 799 Score = 70.5 bits (165), Expect = 2e-12 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 11/137 (8%) Frame = +2 Query: 338 IKRDPESYKEEFHQQLAHFETTLEIFNLNPT-----------QYSKKLDEQAMFLAQVAQ 484 +KRDPE Y+EE Q HFE+++ +F + +K+L + A+FLA VA Sbjct: 35 MKRDPEGYEEELRQLRRHFESSVFLFRQQAALASTSSSGGGGEVAKELGDLALFLAHVAP 94 Query: 485 CYFNEMKTFPQKIVDVLKTHNTTLHNEMRLALCKCLILLRNKNFITPFDLLELFFTLLKC 664 Y +++ P +I +L T+ L + +R+ L + LILL N+ + D +ELF L Sbjct: 95 FYPDDLADLPDQIGGLLDTNARALPSGLRVHLVQALILLVNRKIVDLEDTMELFMELQVI 154 Query: 665 QDKYLRDFLKTHIITDI 715 D+ ++ +HI+ I Sbjct: 155 GDRAVKKLAFSHIVHSI 171 >10_06_0110 + 10889414-10889669,10889756-10889806,10890595-10891163, 10891178-10891660,10891747-10891944,10893300-10893354, 10893372-10893631 Length = 623 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 307 SEQPNAVAKSYKT*SRILQRRVSSTTCTF*DHFRNIQLE 423 SE + +K+YK S +L R TC+ +H R++ LE Sbjct: 247 SEMLSLFSKAYKIASHLLSRTADRLTCSAVEHLRHLLLE 285 >12_02_0515 - 19920411-19921694 Length = 427 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = +2 Query: 521 IVDVLKTHNTTLHNEMR------LALCKCLILLRNKNFITPFDLLELFFTLL 658 +VDV K H TT+ N + +L + L++LR K+F P+ L L+ Sbjct: 357 LVDVTKHHYTTMFNNVNRYCRNPFSLGRHLVILRRKHFSNPWTFFSLVGALM 408 >11_03_0068 + 9564354-9565180,9566658-9568704 Length = 957 Score = 29.5 bits (63), Expect = 3.7 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%) Frame = +2 Query: 467 LAQVAQCYFNEM----KTFPQKIVDVLKTHNTTLHNE-MRLALCKCLILLRNKNFITPFD 631 L +V +CYFNE+ P +I + H +H+ + L + K ++ +NFIT F Sbjct: 468 LEEVGECYFNELINRSMIQPDEIQYDGQAHACRMHDMILDLIISKSVV----ENFITSFS 523 Query: 632 LLELFFTLLKCQDKYLR 682 LL CQDK +R Sbjct: 524 ----HNYLLGCQDKVIR 536 >03_06_0568 - 34778408-34778710,34779340-34779411,34779549-34779635, 34779722-34779880,34780641-34780739,34780823-34780903, 34781007-34781461,34781550-34781679,34781952-34782743 Length = 725 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 216 LKQQKSKYLVP-VCSYYCTKIFXKWLGIIINFRTT*RSCKIL*NVIQN 356 LK ++ LV + S YC K + WLG++++ + S +L +++N Sbjct: 313 LKHERFALLVTCLYSMYCAKNYVGWLGLLLSLNLSFISSDVLVQLLKN 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,371,931 Number of Sequences: 37544 Number of extensions: 317501 Number of successful extensions: 503 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -