BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H21 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 >SB_33427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 786 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 757 TLQNFILACYKIPTPELXNSLLTYLVELYPQNIW 858 TLQNF+ K L L+ELY +N+W Sbjct: 328 TLQNFMYTMLKDSNAVAAKKSLDVLIELYKRNVW 361 >SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +2 Query: 395 ETTLEIFNLNPTQYSKKLDEQAMFLAQVAQCYFNEMKTFPQKIVD 529 ++ L + +L T+Y K ++L C+ ++MK+ PQ I + Sbjct: 390 DSFLRVTHLTRTRYEDKFVFVKLYLLFHLMCFIHDMKSLPQSITE 434 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 515 QKIVDVLKTHNTTLHNEMRLALCKCLILLRNKNFITPFDLLE 640 Q+ V +HN TL E+ + LC+ L+L +F +LL+ Sbjct: 1198 QEYVSEGSSHNCTLSREVGVTLCEALVLADKGDFPGAVELLK 1239 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,813,253 Number of Sequences: 59808 Number of extensions: 421526 Number of successful extensions: 744 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -