Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_H21
         (869 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.            28   0.32 

>AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.
          Length = 722

 Score = 28.3 bits (60), Expect = 0.32
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = +2

Query: 521 IVDVLKTHNTTLHNEMRLALCKCLILLRNKNFITPFDLLELFFTLL 658
           +V+ +   +  L N+ +  LC+  I+LR++NF    +L +L+ TLL
Sbjct: 65  LVNEVDQVSANLPNKRKCLLCRSAIMLRDQNF---QNLTQLYLTLL 107


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 812,035
Number of Sequences: 2352
Number of extensions: 15987
Number of successful extensions: 12
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 93026475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)