BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H17 (870 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 27 4.6 SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 6.1 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 26.6 bits (56), Expect = 4.6 Identities = 22/67 (32%), Positives = 32/67 (47%) Frame = -1 Query: 393 TPSCSPKPGMRVPVRLSPCPFTLSRASPAEAALSLWRSLKSADPMALSTFLSLPVRGTFR 214 TPS + + P +S L ++ E ++S SL S+DP+ STF SL T Sbjct: 129 TPSSTESSSLLDPSSVSSA--ILPSSTSVEVSISS-SSLSSSDPLTSSTFSSLS-SSTSS 184 Query: 213 AAPEVPS 193 + P V S Sbjct: 185 SQPSVSS 191 >SPAC6G9.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 681 Score = 26.2 bits (55), Expect = 6.1 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -1 Query: 390 PSCSPKPGMRVPVRLSPCPFTLSRASPAEAALSLWRS 280 PS + PG VP +S P S S + A+LSL S Sbjct: 310 PSPADTPGFNVPSLISDDPSVSSSLSSSVASLSLQNS 346 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,871,892 Number of Sequences: 5004 Number of extensions: 54560 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 434475230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -