BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H16 (920 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyce... 105 7e-24 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 23 3.4 SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosa... 27 4.9 >SPCC613.05c |rpl35||60S ribosomal protein L35|Schizosaccharomyces pombe|chr 3|||Manual Length = 122 Score = 105 bits (253), Expect = 7e-24 Identities = 56/120 (46%), Positives = 73/120 (60%) Frame = +3 Query: 105 VKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYHQ 284 +K ELR + +LRV K+ GG SKLSKI+ RK IAR+ V ++ Sbjct: 3 LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINE 62 Query: 285 KMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVKA 464 ++ R YKNKKY PLDLR KKTRA+R+ALT +E KT K+I+K+ FP R YA+KA Sbjct: 63 SNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYALKA 122 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 22.6 bits (46), Expect(2) = 3.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 Query: 824 PPPXPPXPG 798 PPP PP PG Sbjct: 9 PPPPPPPPG 17 Score = 22.6 bits (46), Expect(2) = 3.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 821 PPXPPXPGXKKK 786 PP PP PG KK Sbjct: 24 PPPPPPPGYVKK 35 >SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -1 Query: 476 IIYSSFNGIDSRW---EERFLSDLFPRLDLCF 390 +++ +F + + W E FLS +FPR CF Sbjct: 246 VVFGAFPSLHAGWAMLEALFLSHVFPRYRFCF 277 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,299,492 Number of Sequences: 5004 Number of extensions: 31913 Number of successful extensions: 87 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 468512460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -