BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H16 (920 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) 117 2e-26 SB_47982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) 28 9.2 SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) 28 9.2 >SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) Length = 131 Score = 117 bits (281), Expect = 2e-26 Identities = 65/120 (54%), Positives = 76/120 (63%) Frame = +3 Query: 102 KVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYH 281 KVK ELR K + LRVAKVTGG ASKLSKI+VVRK++ARV V Sbjct: 11 KVKAHELRGKKKDELLKQLDELKTELSQLRVAKVTGGAASKLSKIKVVRKSVARVLTVVS 70 Query: 282 QKMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVK 461 Q + NLR Y+ KKY PLDLR K TRAMR++LTK EA KT K+ +K + F R YAVK Sbjct: 71 QTQRDNLRKFYRKKKYLPLDLRPKLTRAMRRSLTKKEASSKTLKQQKKLAHFSLRKYAVK 130 >SB_47982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +3 Query: 216 ASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAMRKALTK 386 ASK SK RV R IA++ H ++ +RN N K +R K+RAM+K T+ Sbjct: 588 ASKKSKKRVGRPDIAQLMRAKHFGIQTEVRN--LNSKCLIFGVRKFKSRAMKKMQTR 642 >SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) Length = 426 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 249 KAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTR 362 KA ++V + H K NL +H+K K+Y P+ R + R Sbjct: 70 KAYSKVRVDNHLFNKENLPSHFKFKEYCPMVFRNLRER 107 >SB_13108| Best HMM Match : PRRSV_2b (HMM E-Value=6.1) Length = 311 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 315 KNKKYKPLDLRAKKTR-AMRKALTKHEAKIKTRKEIRKKSLFPPRVYA 455 +N+K DL K T +M + KH AK+ R E++ S PP V A Sbjct: 104 ENEKLWLSDLVEKSTPCSMDNSRQKHIAKLLLRSEMKGNSELPPHVQA 151 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,797,244 Number of Sequences: 59808 Number of extensions: 256327 Number of successful extensions: 659 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2669453024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -