BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H15 (981 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific ... 33 0.31 U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific... 33 0.31 >U64609-7|AAB04604.3| 373|Caenorhabditis elegans Sperm-specific family, class qprotein 4 protein. Length = 373 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 595 PPPXPPKKXXFXGGXKKKXFFFFXGXGGXGXXXXXXXFFFFXXXXXPXGGGGGGXPPXG 419 PPP GG +F G G G +F P GGGGGG G Sbjct: 281 PPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGG 339 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = -1 Query: 594 PPPXPQKKXXXGGGXKKXXFFFFXXXGGXGXXXXXXXFFFFXXXXXPXGGGGGXXPPXG 418 PPP GGG +F G G +F P GGGGG G Sbjct: 281 PPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGG 339 >U40802-12|AAK19014.2| 265|Caenorhabditis elegans Sperm-specific family, class qprotein 3 protein. Length = 265 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 595 PPPXPPKKXXFXGGXKKKXFFFFXGXGGXGXXXXXXXFFFFXXXXXPXGGGGGGXPPXG 419 PPP GG +F G G G +F P GGGGGG G Sbjct: 175 PPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGG 233 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = -1 Query: 594 PPPXPQKKXXXGGGXKKXXFFFFXXXGGXGXXXXXXXFFFFXXXXXPXGGGGGXXPPXG 418 PPP GGG +F G G +F P GGGGG G Sbjct: 175 PPPPSGSAMGGGGGGGATSAYFGVGSGAMGGGGAGAQSAYFGVGGGPVGGGGGGAKSGG 233 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,360,205 Number of Sequences: 27780 Number of extensions: 268439 Number of successful extensions: 3248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1950 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2552786072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -