BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H14 (861 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 3.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 4.1 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 22 5.4 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 9.5 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 9.5 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 27 GNSLRFDCNSNFLRKRTSPIAMK 95 GN FD +NFL +R PI ++ Sbjct: 23 GNKEVFDVPNNFLPERYKPIGVQ 45 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 763 PTPGGKGRXWVLGPSSG 813 P GKG W L P SG Sbjct: 205 PDKPGKGSFWSLHPDSG 221 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -3 Query: 184 DVPKELDISPTRKWYE*TQTHKDRQRSTRDFIAIGDVRFRRKFELQSNL 38 D P + + T+ Y T R ++F + RRK EL ++L Sbjct: 145 DAPDAIGKTRTKDKYRVVYTDHQRVELEKEFYYSRYITIRRKAELANSL 193 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 775 GKGRXWVLGPSS 810 GKG W+L PS+ Sbjct: 152 GKGNYWMLDPSA 163 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 184 HKLVQYNAIPFMKRVK 231 HK Y+AIP+++ V+ Sbjct: 92 HKCYDYDAIPWLQNVE 107 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +2 Query: 62 PPKAHVSYRNEISRAPLSVLVRLCSLVPFSCRRYIQFL 175 P K + + ++ AP V + + C+R IQF+ Sbjct: 39 PTKTVIQSKRPLAPAPERTSVLVTNNSDLRCKRKIQFM 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,934 Number of Sequences: 336 Number of extensions: 3597 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23866870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -