BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H14 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 2.1 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 23 4.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.8 bits (49), Expect = 2.1 Identities = 11/26 (42%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -1 Query: 327 ARSNVHG-RLTVERVQRLDTCNNFII 253 ARS + G R+T E+++R D +N+I+ Sbjct: 707 ARSLMEGPRMTAEQLKRTDIIHNYIM 732 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 22.6 bits (46), Expect = 4.8 Identities = 20/64 (31%), Positives = 26/64 (40%) Frame = +1 Query: 160 IYPVPWAHHKLVQYNAIPFMKRVKNYFYSSADNKIITGIQALDSLNSKATVNITAGGVGY 339 +Y P H L N PFMK Y +N GIQ + + S A V G + + Sbjct: 266 LYYSPLTSHSLYYVNMEPFMK--SQY---EENNIEYEGIQDIFNTQSSAKVMSKNGVLFF 320 Query: 340 PYVN 351 VN Sbjct: 321 GLVN 324 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,556 Number of Sequences: 438 Number of extensions: 5013 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -