BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H12 (900 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 46 1e-05 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 42 2e-04 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 41 3e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 41 3e-04 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 40 6e-04 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 38 0.003 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 38 0.003 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 37 0.003 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 36 0.008 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 33 0.055 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 32 0.13 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.16 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 24 1.6 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 28 2.1 SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac... 28 2.1 SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyc... 28 2.1 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 27 4.8 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 4.8 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 27 4.8 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.3 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 23 7.7 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 8.4 SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||... 26 8.4 SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyce... 26 8.4 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 26 8.4 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 45.6 bits (103), Expect = 1e-05 Identities = 35/116 (30%), Positives = 35/116 (30%), Gaps = 8/116 (6%) Frame = +1 Query: 457 PPPPXPP---PXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXX 627 PPPP PP P PP PPP P P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Query: 628 X--APAXPPPXXXHRXXXTXPXXXXP---PRAPPXRXXXPPPPXPXPPPPXPPXPP 780 APA PP R T P P P APP PP P P PP PP Sbjct: 397 GRSAPALPPLGNASRTS-TPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPP 451 Score = 38.3 bits (85), Expect = 0.001 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 4/91 (4%) Frame = +2 Query: 461 PXPXPPPXP----PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPPXX 628 P P PPP P PP PP P PP S PP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Query: 629 GRRXPPPPXXXTXXKXXXPXXXXXXAPPPXA 721 GR P P + P + PP A Sbjct: 397 GRSAPALPPLGNASRTSTPPVPTPPSLPPSA 427 Score = 33.1 bits (72), Expect = 0.055 Identities = 28/105 (26%), Positives = 28/105 (26%) Frame = +1 Query: 463 PPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAPAX 642 PP PPP P P P P P APA Sbjct: 388 PPAPPPAIPGRSAPALP-PLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAA 446 Query: 643 PPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXP 777 PP P P APP PP P PPP P P Sbjct: 447 PP--LPPSAPIAPPLPAGMPAAPPL-----PPAAPAPPPAPAPAP 484 Score = 32.3 bits (70), Expect = 0.097 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 461 PXPXPPPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPPXXGRRX 640 P PP PP P PP P P P PP PP Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPA 483 Query: 641 PPPP 652 P P Sbjct: 484 PAAP 487 Score = 30.7 bits (66), Expect = 0.29 Identities = 27/113 (23%), Positives = 27/113 (23%), Gaps = 8/113 (7%) Frame = +1 Query: 457 PPPPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAP 636 P PP P P P P PP P P Sbjct: 231 PIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKP 290 Query: 637 AXPPP-XXXHRXXXTXPXXXXPPRAPPXRXXXPPPP-------XPXPPPPXPP 771 PPP PP PP R PP PPPP PP Sbjct: 291 PLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPP 343 Score = 29.5 bits (63), Expect = 0.68 Identities = 26/120 (21%), Positives = 30/120 (25%), Gaps = 6/120 (5%) Frame = +1 Query: 430 SMTHPXXXXPPPPX------PPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXX 591 S++ P PPP PP P P P P P Sbjct: 247 SLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAA 306 Query: 592 XXXXXXPXXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPP 771 P PP + P PPR+ PP PPP PP Sbjct: 307 NKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 29.5 bits (63), Expect = 0.68 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 610 PXXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 P P PP P P APP P P P P PP P Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAP 480 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 41.5 bits (93), Expect = 2e-04 Identities = 25/63 (39%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -2 Query: 881 GGLXGGGGGXGXMXXXXGXXXPXRGXXXGXKKXXGGXGGXGGGGXGXGG-GGXXXRXGGA 705 GG G GG G G RG G + G GG GG G GG GG GGA Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGR-GGARGGRGGRGGARGGRGGSSGGRGGA 67 Query: 704 RGG 696 +GG Sbjct: 68 KGG 70 Score = 37.9 bits (84), Expect = 0.002 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 809 GXXXGXKKXXGGXGGXGGGGXGXGGGGXXXRXGGARGGXXXXGXVFXXRXXXXGG 645 G G GG GG GGG G GGG GGARGG G R GG Sbjct: 13 GSRGGRGGFNGGRGGFGGGRGGARGGGR----GGARGGRGGRGGARGGRGGSSGG 63 Score = 35.5 bits (78), Expect = 0.010 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -2 Query: 812 RGXXXGXKKXXGGXGGXGGGGXGXGGGGXXXRXGGARGGXXXXGXVFXXRXXXXGG 645 RG G GG GG GG G G GG GG G G R GG Sbjct: 15 RGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 31.5 bits (68), Expect = 0.17 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 644 GXAGAXXXVXXGXGGGAXXPPGXGGGXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXG 465 G G G GG G GGG GG G G G G GG G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Query: 464 G 462 G Sbjct: 66 G 66 Score = 31.1 bits (67), Expect = 0.22 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -2 Query: 611 GXGGGAXXPPGXGGGXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGGGGXXXXG 441 G GG G GG G GG G G G G GG GG G Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 Score = 31.1 bits (67), Expect = 0.22 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = -1 Query: 651 GGGGXRRPXXGGXXXGGGXGXPPREXGGRXXRXXGXGXXGGXXXXXXXXGGXGXGGXGGG 472 GG R G G G G GGR G G GG GG G G G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGG------ARGGRGGSSGGRG 65 Query: 471 XGXGGXXXXXVGHR 430 GG HR Sbjct: 66 GAKGGAKVIIEPHR 79 Score = 29.9 bits (64), Expect = 0.52 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -2 Query: 644 GXAGAXXXVXXGXGGGAXXPPGXGGGXXXXXXGGXXXGGGXXGXXXXG-GXGXGXXGGGX 468 G G G GG G GG GG G G G G G G GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAK 68 Query: 467 GG 462 GG Sbjct: 69 GG 70 Score = 29.5 bits (63), Expect = 0.68 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -2 Query: 611 GXGGGAXXPPGXGGGXXXXXXG-GXXXGGGXXGXXXXGGXGXGXXGGGXGGGGXXXXG 441 G GG G GG G G GG G G G GG GG G G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 27.5 bits (58), Expect = 2.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 710 GARGGXXXXGXVFXXRXXXXGGGXAGAXXXVXXGXGGGAXXPPGXGGGXXXXXXGGXXXG 531 G RGG F GGG GA G GG G GG G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAK 68 Query: 530 GG 525 GG Sbjct: 69 GG 70 Score = 25.8 bits (54), Expect = 8.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -2 Query: 584 PGXGGGXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGGG 459 PG GG G GG G G G GG GG Sbjct: 5 PGSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGG 46 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 40.7 bits (91), Expect = 3e-04 Identities = 33/103 (32%), Positives = 34/103 (33%) Frame = -2 Query: 746 GXGGGGXXXRXGGARGGXXXXGXVFXXRXXXXGGGXAGAXXXVXXGXGGGAXXPPGXGGG 567 G GGG GG+ G G G G G G GG P G GG Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPG-------GFGGFGGFGGEGHHHGGHGGFGGGPGGFEGG 236 Query: 566 XXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGGGGXXXXGW 438 G GGG GG G G G G G GG GW Sbjct: 237 PGGFGGGPGGFGGG------LGGFGGGPGGFGGGPGGHGGPGW 273 Score = 36.3 bits (80), Expect = 0.006 Identities = 31/105 (29%), Positives = 32/105 (30%) Frame = -2 Query: 881 GGLXGGGGGXGXMXXXXGXXXPXRGXXXGXKKXXGGXGGXGGGGXGXGGGGXXXRXGGAR 702 GGL GG + G G GG GG G GG G G Sbjct: 164 GGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGH 223 Query: 701 GGXXXXGXVFXXRXXXXGGGXAGAXXXVXXGXGGGAXXPPGXGGG 567 GG F GGG G G GG P G GGG Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGG----FGGGLGGFGGGPGGFGGG 264 Score = 35.9 bits (79), Expect = 0.008 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 896 GKXRXGGLXGGGGGXGXMXXXXGXXXPXRGXXXGXKKXXGGXGGXGGGGXGXGGGGXXXR 717 G GG GG GG G G G G GG G GGG G GGG Sbjct: 203 GPGGFGGF-GGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGG- 260 Query: 716 XGGARGGXXXXG 681 GG GG G Sbjct: 261 FGGGPGGHGGPG 272 Score = 32.7 bits (71), Expect = 0.073 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = -2 Query: 881 GGLXGGGGGXGXMXXXXGXXXPXRGXXXGXKKXXGGXGGXGGGGXGXGGGGXXXRXGGAR 702 GG G GGG G G G G GG GG G G G G GG Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGF-GGFGGEGHHHGGHGGFG--GGPGGFEGGPGGFGGGP 244 Query: 701 GGXXXXGXVFXXRXXXXGGGXAG 633 GG F GGG G Sbjct: 245 GGFGGGLGGFGGGPGGFGGGPGG 267 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 40.7 bits (91), Expect = 3e-04 Identities = 33/120 (27%), Positives = 34/120 (28%), Gaps = 1/120 (0%) Frame = +1 Query: 463 PPXPPPXXPXPXP-PXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAPA 639 PP P P P P P P P P PP P + AP Sbjct: 1112 PPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVA-APP 1170 Query: 640 XPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPPXXFFXPXXXPRXG 819 P P P PP PP PP P P PP PP P P G Sbjct: 1171 VPAPSSGI-PPVPKPAAGVPPVPPPSEA----PPVPKPSVGVPPVPPPSTAPPVPTPSAG 1225 Score = 37.1 bits (82), Expect = 0.003 Identities = 29/112 (25%), Positives = 29/112 (25%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXT 621 P PP P P P P P P P P PP Sbjct: 1126 PSVAAPPVPVPSGAPPVPKPSVAAPPV-PAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Query: 622 XXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXP 777 P PPP P PP PP PP P P PP P Sbjct: 1185 AAGVPPVPPPS--EAPPVPKPSVGVPPVPPP----STAPPVPTPSAGLPPVP 1230 Score = 37.1 bits (82), Expect = 0.003 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 2/97 (2%) Frame = +2 Query: 437 PTXXXXXPPXPXPPPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXX 616 P PP P P PP P P P P P + G P PPP Sbjct: 1143 PKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPV-----PKPAAGVPPVPPPSEA 1197 Query: 617 P--PXXGRRXPPPPXXXTXXKXXXPXXXXXXAPPPXA 721 P P PP P T P P P A Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTA 1234 Score = 36.7 bits (81), Expect = 0.004 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 458 PPXPXPPPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPPXXGRR 637 PP P P PP P PP P P P G P P P PP Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSA--PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPS 1098 Query: 638 XPPPP 652 PP Sbjct: 1099 VAAPP 1103 Score = 35.9 bits (79), Expect = 0.008 Identities = 24/90 (26%), Positives = 24/90 (26%), Gaps = 4/90 (4%) Frame = +2 Query: 458 PPXPXPPPXPPXPXPPXXXXXXXXP----PXXPXPXXRXXRPPXSRGGXPXPPPXXXPPX 625 PP P P PP P P P P P P P S P P P PP Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPV 1142 Query: 626 XGRRXPPPPXXXTXXKXXXPXXXXXXAPPP 715 PP P P P Sbjct: 1143 PKPSVAAPPVPAPSGAPPVPKPSVAAPPVP 1172 Score = 33.9 bits (74), Expect = 0.032 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 5/77 (6%) Frame = +2 Query: 437 PTXXXXXPPXPXP----PPXP-PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXP 601 P PP P P PP P P PP PP P P P S P P Sbjct: 1095 PKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPV-PVPSGAPPVPKPSVAAPPVP 1153 Query: 602 PPXXXPPXXGRRXPPPP 652 P PP PP Sbjct: 1154 APSGAPPVPKPSVAAPP 1170 Score = 32.7 bits (71), Expect = 0.073 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +2 Query: 437 PTXXXXXPPXPXP----PPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPP 604 P PP P P PP PP P P P P P S G P P Sbjct: 1172 PAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPV 1231 Query: 605 PXXXPP 622 P P Sbjct: 1232 PTAKAP 1237 Score = 31.9 bits (69), Expect = 0.13 Identities = 32/131 (24%), Positives = 34/131 (25%), Gaps = 1/131 (0%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXT 621 P PP P P P P P P PP + Sbjct: 1007 PLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPV-----------PKS 1055 Query: 622 XXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXP-PXXFFXP 798 AP+ PPP P P APP PP P P PP P P P Sbjct: 1056 SSGAPSAPPPVP--APSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPP 1113 Query: 799 XXXPRXGXXXP 831 P P Sbjct: 1114 VPAPSGAPPVP 1124 Score = 31.9 bits (69), Expect = 0.13 Identities = 24/103 (23%), Positives = 25/103 (24%), Gaps = 1/103 (0%) Frame = +1 Query: 463 PPXPPPXXPXPXPPXXXX-PXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAPA 639 PP P P P P P PPP P + A Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVA 1100 Query: 640 XPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXP 768 PP P P P PP P P PP P Sbjct: 1101 APPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVP 1143 Score = 31.1 bits (67), Expect = 0.22 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 7/93 (7%) Frame = +2 Query: 458 PPXPXP----PPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPP---XXX 616 PP P P PP P P P P P P S P P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPP 1180 Query: 617 PPXXGRRXPPPPXXXTXXKXXXPXXXXXXAPPP 715 P PP P P PPP Sbjct: 1181 VPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPP 1213 Score = 30.7 bits (66), Expect = 0.29 Identities = 28/110 (25%), Positives = 28/110 (25%), Gaps = 3/110 (2%) Frame = +1 Query: 460 PPPXPPPXXPXPXPPXXXX--PXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXX- 630 P P PP P P P P PP PP P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSK 1020 Query: 631 APAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 AP P P P P APP PP P P PP Sbjct: 1021 APPVPLPSAD------APPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPP 1064 Score = 28.7 bits (61), Expect = 1.2 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +2 Query: 437 PTXXXXXPPXPXP---PPXP-PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXP- 601 P P P P PP P P PP PP P P P G P P Sbjct: 1067 PAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP-VPKPSVAVPPVPAPSGAPPVPK 1125 Query: 602 PPXXXPPXXGRRXPPP 649 P PP PP Sbjct: 1126 PSVAAPPVPVPSGAPP 1141 Score = 27.5 bits (58), Expect = 2.7 Identities = 27/115 (23%), Positives = 27/115 (23%) Frame = +1 Query: 424 KFSMTHPXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXX 603 K S P P PP P PP PP P Sbjct: 1016 KLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPP---VPKSSSGAPSAPPPVPAPSSE 1072 Query: 604 XXPXXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXP 768 AP P P P PP P PP P P PP P Sbjct: 1073 IPSIPAPSGAPPVPAPSGI--PPVPKPSVAAPP-VPKPSVAVPPVPAPSGAPPVP 1124 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPP 549 P PP P P P P P P P PP Sbjct: 1203 PSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPP 1238 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 39.5 bits (88), Expect = 6e-04 Identities = 22/67 (32%), Positives = 25/67 (37%) Frame = -2 Query: 896 GKXRXGGLXGGGGGXGXMXXXXGXXXPXRGXXXGXKKXXGGXGGXGGGGXGXGGGGXXXR 717 G + G G G G G RG G + G G GG G G GG Sbjct: 123 GPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGF 182 Query: 716 XGGARGG 696 GG+RGG Sbjct: 183 RGGSRGG 189 Score = 31.5 bits (68), Expect = 0.17 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 602 GGAXXPPGXGG-GXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGGG 459 G P G GG G GG G G GG G GGG GG Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 27.5 bits (58), Expect = 2.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 599 GAXXPPGXGGGXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGGG 459 G P G G G GG GG G GGG GG Sbjct: 123 GPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGG 169 Score = 27.1 bits (57), Expect = 3.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 779 GGXGGXGGGGXGXGGGGXXXRXGGARGGXXXXGXVFXXRXXXXGGGXAG 633 GG G GG G GG GG G G R GG G Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 26.6 bits (56), Expect = 4.8 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 611 GXGGGAXXPPGXGGGXXXXXXGGXXXGGGXXGXXXXGGXGXGXXGGGXGG 462 G GG G GG GG GGG G G G G GG GG Sbjct: 139 GRGGFRGGRGGSRGGFGGNSRGGF--GGGSRGGFGGGSRG-GSRGGFRGG 185 Score = 25.8 bits (54), Expect = 8.4 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = -1 Query: 642 GXRRPXXGGXXXGGGXGXPPREXGGRXXRXXGXGXXGGXXXXXXXXGGXGXGGXGGGXG 466 G ++P G G G GGR G G GG G G GG G Sbjct: 123 GPKKPK-GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRG 180 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 797 GXKKXXGGXGGXGG-GGXGXGGGGXXXRXGGARGGXXXXGXV 675 G + GG GG GG GG G GGG GGAR G G V Sbjct: 448 GSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSGNPNRGSV 489 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 37.5 bits (83), Expect = 0.003 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Frame = +1 Query: 631 APAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXP-----XPPPPXPPXP 777 +P PPP P PP AP PPPP P PPPP PP P Sbjct: 731 SPPPPPPAVIVPTPAPAPIPVPPP-APIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 34.7 bits (76), Expect = 0.018 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 488 PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPPXXGRRXPPPP 652 P P PP P P P P GG P PPP PP PPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPP-----PAPIMGGPPPPPP---PPGVAGAGPPPP 778 Score = 33.1 bits (72), Expect = 0.055 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 643 PPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPP------PPXPPXPP 780 PPP T P P PP PPP P PP PP PP PP Sbjct: 732 PPPPPPAVIVPT-PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 31.1 bits (67), Expect = 0.22 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +1 Query: 457 PPPPXP------PPXXPXPXPPXXXXPXXPPPXXXPP 549 PPPP P P P P PP PPP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 30.3 bits (65), Expect = 0.39 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 682 PXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPPXXFFXPXXXP 810 P P AP PP P PPP PP P P P Sbjct: 737 PAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 30.3 bits (65), Expect = 0.39 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPP 549 P PP P P P PP PPP PP Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 29.9 bits (64), Expect = 0.52 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 697 PPRAPPXRXXXPPPPXPXPPPPXPPXPPXXFFXP 798 PP PP PP P PPPP ++ P Sbjct: 762 PPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAP 795 Score = 29.5 bits (63), Expect = 0.68 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 473 PPPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPP 622 PPP P P PP P PP PPP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 29.1 bits (62), Expect = 0.90 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 5/41 (12%) Frame = +1 Query: 442 PXXXXPPPPXPPP-----XXPXPXPPXXXXPXXPPPXXXPP 549 P P P PPP P P PP PPP PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 28.7 bits (61), Expect = 1.2 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +2 Query: 458 PPXPX---PPPXP-PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPP 607 PP P P P P P P PP PP P P + G P PPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGV-------AGAGPPPPPP 780 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 531 PXPXPXPXXGXXAPPXPGGGXRXPPXXXXHXXXGAGXPPPXXXXP 665 P P P P P GG PP GAG PPP P Sbjct: 742 PTPAPAPIPVPPPAPIMGGP---PPPPPPPGVAGAGPPPPPPPPP 783 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPP 534 P P P P P P P P PPP Sbjct: 736 PPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP 766 Score = 26.2 bits (55), Expect = 6.3 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 3/56 (5%) Frame = +2 Query: 461 PXPXPPPXP---PXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXP 619 P P PPP P P PP P P P SR P P P Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEPEP 803 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 37.1 bits (82), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 631 APAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 APA P R P P PP PPPP P P PP P Sbjct: 1682 APAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAP 1731 Score = 32.3 bits (70), Expect = 0.097 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 706 APPXRXXXPPPPXPXPPPPXPPXPPXXFFXPXXXP 810 APP PPP P PP P PP P P Sbjct: 1698 APPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 31.1 bits (67), Expect = 0.22 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPP 549 P P P PPP P P P PP PP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXPXXPPP 534 P PP P PP P P P P P P Sbjct: 1716 PPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 27.9 bits (59), Expect = 2.1 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 461 PXPXPPPXPPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSRGGXPXPPPXXXPPXXGRRX 640 P PP P PP PP P P G P PP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPP--PSAPPMPAGPPSAPPPPLPASSAPSV 1743 Query: 641 PPP 649 P P Sbjct: 1744 PNP 1746 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 433 MTHPXXXXPPPPXPPPXXPXPXPPXXXXPXXPPP 534 M+ P PP PPP P P P PPP Sbjct: 1702 MSAPTPPPPPMSVPPPPSAPPMP--AGPPSAPPP 1733 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +1 Query: 457 PPPPXPPPXXPXPXPPXXXXPXXPPPXXXP 546 PPPP P PP P PP P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 25.8 bits (54), Expect = 8.4 Identities = 17/64 (26%), Positives = 17/64 (26%), Gaps = 1/64 (1%) Frame = +1 Query: 610 PXXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPP-PPXPPXPPXX 786 P AP PP H P P P PP P PP P P Sbjct: 1436 PGAPSNHAPQVVPPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLPPAVPNVPVP 1495 Query: 787 FFXP 798 P Sbjct: 1496 SMIP 1499 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 35.9 bits (79), Expect = 0.008 Identities = 39/155 (25%), Positives = 43/155 (27%), Gaps = 4/155 (2%) Frame = +1 Query: 328 RKHRKPEK*FFSI*VHNPKYIECNNVLDVIE*KFSMTH-PXXXXPPPPXP-PPXXPXPXP 501 + H KPE PK+ E D + +F H P PPPP P P P Sbjct: 168 KSHPKPEDDSVFFDDERPKHHE----FDDEDREFPAHHEPGEHMPPPPMHHKPGEHMPPP 223 Query: 502 PXXXXPXX--PPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAPAXPPPXXXHRXXX 675 P P PPP P PPP H Sbjct: 224 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGE 283 Query: 676 TXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 P PP PPPP P P PP Sbjct: 284 HMPP---PPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 33.9 bits (74), Expect = 0.032 Identities = 29/116 (25%), Positives = 29/116 (25%), Gaps = 3/116 (2%) Frame = +1 Query: 442 PXXXXPPPPXP-PPXXPXPXPPXXXXPXX--PPPXXXPPXXXXXXXXXXXXXXXXXXXXP 612 P PPPP P P PP P PPP P Sbjct: 216 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 275 Query: 613 XXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 PPP H P PP PPPP P P PP Sbjct: 276 PMHHEPGEHMPPPPMHHEPGEHMPP---PPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 33.9 bits (74), Expect = 0.032 Identities = 29/116 (25%), Positives = 29/116 (25%), Gaps = 3/116 (2%) Frame = +1 Query: 442 PXXXXPPPPXP-PPXXPXPXPPXXXXPXX--PPPXXXPPXXXXXXXXXXXXXXXXXXXXP 612 P PPPP P P PP P PPP P Sbjct: 229 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 288 Query: 613 XXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 PPP H P PP PPPP P P PP Sbjct: 289 PMHHEPGEHMPPPPMHHEPGEHMPP---PPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 263 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 276 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 289 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 302 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 315 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 328 Score = 28.3 bits (60), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +2 Query: 485 PPXPXPPXXXXXXXXPPXXPXPXXRXXRPPXSR--GGXPXPPPXXXPPXXGRRXPPPP 652 PP P PP P PP G PPP P G PPPP Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEP--GEHMPPPP 341 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 33.1 bits (72), Expect = 0.055 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXRXXXPPPPXPXPPPPXPPXPP 780 PP PPPP PP PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 31.5 bits (68), Expect = 0.17 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 697 PPRAPPXRXXXPPPPXPXPPPPXPPXPPXXF 789 PP PP PPPP PP PP PP + Sbjct: 5 PPGNPPP---PPPPPGFEPPSQPPPPPPPGY 32 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 442 PXXXXPPPPXPPPXXPXPXPPXXXXP 519 P PPPP PP P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 473 PPPXPPXPXPPXXXXXXXXPPXXPXP 550 PP PP P PP PP P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 682 PXXXXPPRAPPXRXXXPPPPXPXPPP 759 P PP PP P P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 457 PPPPXPPPXXPXPXPPXXXXPXXPPP 534 PP PPP P P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 733 PPPXPXPPPPXPPXPPXXFFXPXXXP 810 PP P PPPP P P P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.9 bits (69), Expect = 0.13 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +1 Query: 631 APAXPPPXXXHRXXXTXPXXXXPPRAPPXRXXXPPPPXPXPPPPXPPXPPXXFFXPXXXP 810 APA P P R + P P PP PP P PP P PP P P Sbjct: 127 APAPPTPQSELRPPTSAPPRPSIP--PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Query: 811 RXGXXXP 831 P Sbjct: 185 PSAPSLP 191 Score = 31.1 bits (67), Expect = 0.22 Identities = 23/101 (22%), Positives = 25/101 (24%), Gaps = 1/101 (0%) Frame = +1 Query: 499 PPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXXPXXTXXXAPAXPPPXXXHRXXXT 678 PP P P PP P + PPP + Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 679 XPXXXXPPRA-PPXRXXXPPPPXPXPPPPXPPXPPXXFFXP 798 P P A PP PPPP P P F P Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPP 224 Score = 29.5 bits (63), Expect = 0.68 Identities = 31/128 (24%), Positives = 33/128 (25%), Gaps = 8/128 (6%) Frame = +1 Query: 430 SMTHPXXXXPPPPXPPPXXPXPXPPXXXXPXXPPPXXXPPXXXXXXXXXXXXXXXXXXXX 609 S P PP P PP P PP P PP Sbjct: 135 SELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPP----AQPAAPVKSPPSAPSL 190 Query: 610 PXXTXXXAPAXPPPXXXH---RXXXTXPXXXXPP--RAPPXRXXXPPPPXPXPPPP---X 765 P P PPP + P PP AP P P P P Sbjct: 191 PSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSIPSASV 250 Query: 766 PPXPPXXF 789 PP PP + Sbjct: 251 PPVPPSSY 258 Score = 26.6 bits (56), Expect = 4.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 457 PPPPXPPPXXPXPXPP 504 PPPP P P P PP Sbjct: 7 PPPPAPAPAAAAPAPP 22 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.1 bits (67), Expect = 0.22 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 700 PRAPPXRXXXPPPPXPXPPPPXPPXPP 780 P PP P P PPPP PP P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLP 247 Score = 29.1 bits (62), Expect = 0.90 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 697 PPRAPPXRXXXPPPPXPXPPPPXPP 771 PP P + P P P PPP PP Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 682 PXXXXPPRAPPXRXXXPPPPXPXPPPPXPP 771 P PP A P P PPPP PP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 27.1 bits (57), Expect = 3.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 461 PXPXPPPXPPXPXPP 505 P P PPP PP PP Sbjct: 234 PLPAPPPPPPPTLPP 248 Score = 25.8 bits (54), Expect = 8.4 Identities = 12/30 (40%), Positives = 12/30 (40%), Gaps = 2/30 (6%) Frame = +1 Query: 697 PPRAPPXRXXXPPPPXPXP--PPPXPPXPP 780 PP P P P PPP PP PP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 25.4 bits (53), Expect(2) = 0.16 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 457 PPPPXPPPXXPXPXPPXXXXPXXPP 531 PP P P P PP P PP Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 24.6 bits (51), Expect(2) = 0.16 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 442 PXXXXPPPPXPPP 480 P PPPP PPP Sbjct: 184 PSDYNPPPPPPPP 196 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 745 PXPPPPXPPXPP 780 P PPP PP PP Sbjct: 942 PAFPPPPPPPPP 953 Score = 23.4 bits (48), Expect(2) = 5.5 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 736 PPXPXPPPPXPPXPPXXFFXP 798 PP P PPPP F P Sbjct: 945 PPPPPPPPPLVSAAGGKFVSP 965 Score = 22.6 bits (46), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 739 PXPXPPPPXP 768 P P PPPP P Sbjct: 905 PTPPPPPPLP 914 Score = 21.0 bits (42), Expect(2) = 5.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 730 PPPPXPXPPPP 762 P P P PPPP Sbjct: 942 PAFPPPPPPPP 952 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 27.9 bits (59), Expect = 2.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 458 PPXPXPPPXPPXP 496 PP P PPP PP P Sbjct: 807 PPAPLPPPAPPLP 819 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 733 PPPXPXPPPPXPPXP 777 PPP P PPP PP P Sbjct: 806 PPPAPL-PPPAPPLP 819 >SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 138 VHAFVKRDAPKEDNSINTLAESAKKTIEELREKVESALAPETVKKNFGT 284 V A +K+D +E S L TIE+L+ K E+ P K F + Sbjct: 128 VQALIKQDFEREHTSPPELPTKLVNTIEKLKVKEENEAPPVIPAKPFSS 176 >SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 379 Score = 27.9 bits (59), Expect = 2.1 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -2 Query: 776 GXGGXGGGGXGXGGGGXXXRXGGARGGXXXXGXVFXXRXXXXGGGXAG 633 G GG GGG G GG G G G + GGG AG Sbjct: 135 GGGGMGGGMGGMGGMDDDMDMDGGFGTRTRGGGMPGGFANMFGGGGAG 182 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 26.6 bits (56), Expect = 4.8 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = -3 Query: 256 GAKADSTFSLNSSIVFFALSASVFMLLSSLGASRLTNACTLARQIANKIISSLFILD 86 G A + F ++ SIV+ A+ ++V + + A ++ NK+ S L++LD Sbjct: 410 GYMAITKFEVSQSIVYSAIVSAVAEFIRQILAEDQLLLNNFFEELKNKLESDLYLLD 466 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 460 PPPXPPPXXPXPXPPXXXXPXXPPPXXXP 546 PPP PP P PP PP P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 682 PXXXXPPRAPPXRXXXPPPPXPXPPPPXP 768 P P AP P P PPPP P Sbjct: 1074 PSNISKPSAPVANNVSKPSAVPPPPPPPP 1102 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 168 KEDNSINTLAESAKKTIEELREKVESAL 251 KE NSI+ L+ S +KTIE R + S + Sbjct: 371 KEKNSISELSPSLQKTIEWARVNLASTI 398 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 23.0 bits (47), Expect(2) = 7.7 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +1 Query: 460 PPPXPPPXXPXPXPPXXXXPXXPP 531 P P P P P P P PP Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPP 748 Score = 21.0 bits (42), Expect(2) = 7.7 Identities = 9/35 (25%), Positives = 12/35 (34%) Frame = +1 Query: 610 PXXTXXXAPAXPPPXXXHRXXXTXPXXXXPPRAPP 714 P +P+ PP H T P +PP Sbjct: 747 PPVRSSISPSMPPAPLTHANSSTPMNYVSQPESPP 781 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 25.8 bits (54), Expect = 8.4 Identities = 18/71 (25%), Positives = 25/71 (35%) Frame = +2 Query: 338 ESLRSNFLVSKYITPNISNVIMFSTLLNKSFL*PTXXXXXPPXPXPPPXPPXPXPPXXXX 517 ES+ N S+ P ++ ++ L + L P P P PP P P P Sbjct: 78 ESISKNEPTSEASKPLLNELVPEEPLPREPPL-PNEPVPEEPLPGEPPLPDEPVPEEPLP 136 Query: 518 XXXXPPXXPXP 550 P P P Sbjct: 137 GEPPLPNEPVP 147 >SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||Manual Length = 252 Score = 25.8 bits (54), Expect = 8.4 Identities = 16/75 (21%), Positives = 36/75 (48%) Frame = -2 Query: 422 YSITSRTLLHSIYLGLCT*ILKNYFSGFRCFRGLQIFIKFVEAVYHRAKVFLNSLRGQGG 243 Y + R +++ YL + + ++Y GF FR ++ ++ + + H+ ++ + + G G Sbjct: 60 YDLEQRMIIYKDYLCIEK-LEEDYVPGFLSFREIKWYLPLLNHIPHQFRIDIILVDGNGV 118 Query: 242 FNFFPQFLNCFLRTL 198 + L C L L Sbjct: 119 LHPVGFGLACHLGVL 133 >SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyces pombe|chr 2|||Manual Length = 292 Score = 25.8 bits (54), Expect = 8.4 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 272 KLWHDGRQLQRIL*KSEARGSTESL-RSNFLVSKYITPN 385 K W DGR+ RIL ++E R S ++ RSN +Y N Sbjct: 216 KKWSDGRR-DRILKQAEERRSNRAVGRSNLSGREYFESN 253 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.8 bits (54), Expect = 8.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 697 PPRAPPXRXXXPPPPXPXPPPPXPPXPP 780 PP PP P P P P P P P Sbjct: 522 PPMVPPGMALPPGMPAPFPGYPAVPAMP 549 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,722,027 Number of Sequences: 5004 Number of extensions: 60023 Number of successful extensions: 988 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -