BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H10 (1102 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 33 7e-04 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 36 0.001 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.004 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 39 0.008 07_01_0080 + 587674-588510 33 0.019 03_05_0161 + 21400580-21401695 28 0.024 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 35 0.028 09_06_0125 - 21011757-21012428 37 0.033 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.065 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 0.11 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 0.11 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 27 0.15 01_07_0082 - 40965947-40967023 27 0.15 07_03_0890 - 22332768-22333382 29 0.16 12_02_0299 - 17051570-17052474,17053542-17053755 34 0.17 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 34 0.17 07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609... 34 0.23 06_01_0561 - 3983308-3983564,3983652-3983775 33 0.30 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 28 0.33 08_02_0839 + 21693348-21694853 33 0.40 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 33 0.53 07_03_1136 + 24218601-24218734,24218769-24219906 33 0.53 07_03_0600 + 19866757-19867218,19867920-19868429 33 0.53 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 32 0.70 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 32 0.70 01_03_0005 + 11568545-11569119,11569179-11569191 32 0.70 01_01_0046 - 331758-332627 30 0.75 10_08_0115 + 14924463-14924939 29 0.79 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 30 0.86 06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 26 0.91 07_03_1788 + 29523216-29524867,29525048-29525075 27 0.92 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 32 0.93 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 32 0.93 01_01_0570 - 4231100-4232560 32 0.93 01_01_0083 + 631196-631675 32 0.93 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 29 0.95 05_01_0380 + 2978256-2979284 29 0.96 01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 28 1.2 06_03_1363 - 29576265-29577575 28 1.2 09_04_0580 + 18681019-18681475,18682637-18682920,18683088-186833... 31 1.2 07_03_0560 + 19479597-19480667 31 1.2 07_03_0177 - 14770777-14772045 31 1.2 02_04_0382 - 22501041-22501279,22501717-22501810 31 1.2 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.2 01_05_0423 + 22032940-22033695 31 1.2 01_02_0031 + 10364487-10365407 27 1.3 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 27 1.5 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 27 1.5 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 28 1.6 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 27 1.6 06_03_0704 + 23706318-23707024,23707093-23707222 31 1.6 02_05_0407 + 28715332-28715385,28715528-28715680,28715810-287158... 31 1.6 01_01_0715 - 5542648-5543219,5543352-5543544 28 1.7 04_01_0034 - 401208-402923 25 2.0 04_04_1542 - 34264994-34265331,34266195-34267029 27 2.1 02_05_1277 - 35408097-35409080 28 2.1 11_01_0621 - 4981070-4981136,4982906-4983825 27 2.1 12_02_0617 + 21256745-21256943,21257454-21257647,21257836-212580... 31 2.1 12_01_0454 + 3580332-3581714 31 2.1 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 2.1 08_02_1256 + 25645085-25645396 31 2.1 08_02_1019 - 23657175-23658047 31 2.1 06_03_1310 + 29238644-29240260 31 2.1 06_03_0790 - 24636805-24637770 31 2.1 03_02_0342 - 7645323-7645909,7646323-7646491 31 2.1 02_05_0002 - 24849189-24849825,24850267-24850328 31 2.1 02_04_0400 - 22608519-22608844,22609044-22609122 31 2.1 07_01_0753 - 5799733-5799741,5799938-5800642 28 2.2 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 2.6 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 26 2.6 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 27 2.6 09_04_0093 - 14550806-14552452 25 2.6 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 27 2.6 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 28 2.7 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 28 2.8 06_03_0696 + 23617687-23617851,23618838-23619536 28 2.8 10_05_0028 - 8311041-8311709,8312175-8312478,8314768-8314841 30 2.8 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 30 2.8 06_02_0127 + 12140843-12140966,12141170-12141567 30 2.8 06_02_0126 + 12130409-12130532,12131015-12131373 30 2.8 06_01_0096 - 794148-794246,795682-796975,798960-799417 30 2.8 05_01_0137 + 917533-917814,918080-918352 30 2.8 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 30 2.8 04_04_0360 - 24684159-24684565,24684654-24685089 30 2.8 03_05_0630 + 26260159-26260272,26260520-26260894 30 2.8 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 30 2.8 07_03_1381 - 26166673-26166747,26166972-26167544 26 2.8 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 27 3.1 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 30 3.3 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 26 3.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 3.4 03_02_0738 - 10824121-10825572 25 3.4 02_04_0289 + 21615745-21616155,21617417-21617870,21618162-216182... 25 3.5 06_01_0744 + 5565939-5566249,5566383-5566476,5569067-5569124,556... 23 3.6 04_03_1022 - 21778315-21779007 27 3.7 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 30 3.7 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 30 3.7 07_03_1382 - 26170563-26170631,26171151-26171843 30 3.7 03_06_0599 + 34984869-34985319,34986581-34987563 30 3.7 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 30 3.7 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 30 3.7 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 30 3.7 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 3.7 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 24 4.2 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 26 4.3 12_01_0442 + 3495333-3496484 23 4.3 06_03_0082 + 16363742-16364632 25 4.6 12_02_1219 + 27096477-27096590,27096704-27097078 29 5.0 05_05_0135 - 22626163-22626198,22626391-22626441,22626516-226266... 29 5.0 03_01_0515 - 3864796-3865425 29 5.0 01_06_1792 - 39912714-39913559 29 5.0 01_06_1365 - 36690267-36692222 29 5.0 01_01_0929 - 7344911-7345978 29 5.0 02_04_0001 - 18816492-18816741,18816881-18817050,18817244-188173... 27 5.7 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 26 5.9 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 26 5.9 12_02_1274 - 27480012-27480383 29 6.5 11_01_0422 + 3246528-3248606 29 6.5 10_01_0026 - 351737-353443 29 6.5 09_02_0327 - 7284829-7284889,7284946-7286126 29 6.5 08_01_0546 - 4746118-4746580,4747335-4747342 29 6.5 07_03_1751 - 29215074-29216270 29 6.5 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 29 6.5 07_03_0559 + 19475893-19476783 29 6.5 07_03_0558 + 19461369-19462448 29 6.5 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 29 6.5 05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094,450... 29 6.5 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 29 6.5 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 6.5 03_01_0023 + 198414-198968 29 6.5 02_05_0149 + 26290236-26290880 29 6.5 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 29 6.5 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 29 6.5 02_02_0240 + 8196140-8198248,8198381-8198650 29 6.5 02_01_0789 - 5919271-5919411,5920105-5920215,5920303-5920401,592... 29 6.5 01_05_0490 + 22672241-22674679 29 6.5 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 26 7.1 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 26 7.2 12_02_0859 - 23751198-23753258 25 7.2 04_03_0057 + 10407402-10407452,10407540-10407782,10408506-104089... 25 7.5 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 25 7.6 02_05_1251 - 35249550-35249814,35249962-35250347,35250489-352505... 24 7.6 02_01_0381 - 2764331-2764342,2768966-2769907 25 7.8 08_02_0937 + 22801526-22802461 29 7.8 07_01_0015 + 108338-109186 26 7.9 10_03_0023 - 7151465-7152111,7152222-7152405 26 7.9 05_04_0011 + 17139322-17139451,17139552-17140174 25 7.9 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 25 8.1 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 24 8.6 12_02_1174 - 26696869-26698191 29 8.7 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 29 8.7 10_08_0912 - 21520088-21520426,21520534-21520674,21521235-215212... 29 8.7 10_08_0234 - 16067579-16068157 29 8.7 10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 29 8.7 09_06_0283 + 22024779-22026134,22026181-22026714 29 8.7 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 8.7 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 8.7 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 29 8.7 08_01_0059 - 394001-394708 29 8.7 07_03_1350 - 25955624-25955842,25955877-25955922,25956456-25956751 29 8.7 06_03_1153 - 28047125-28047751 29 8.7 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 29 8.7 06_01_0178 + 1386981-1387505 29 8.7 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 8.7 04_04_1182 + 31531426-31531702,31533741-31533997,31534672-315348... 29 8.7 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 29 8.7 03_05_0252 - 22403504-22404676 29 8.7 02_04_0028 + 19027510-19027983,19028087-19028278,19028369-190285... 29 8.7 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 8.7 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 23 9.4 11_06_0671 + 26099292-26099491,26099589-26099622,26104787-261048... 26 9.5 08_02_1615 + 28257275-28258428,28258523-28259144 25 9.5 02_03_0279 + 17250347-17252098 26 9.5 06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258,438... 24 9.6 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 24 9.8 03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 26 9.9 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 25 9.9 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 26 10.0 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.1 bits (72), Expect = 0.40 Identities = 22/76 (28%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPPXFFX-FXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A G PP G + PPPPPP + P PPP Sbjct: 37 AYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPP 96 Query: 926 PPKXPXXXFLPPPXPP 973 PP PPP PP Sbjct: 97 PPYGVNSSQPPPPPPP 112 Score = 33.1 bits (72), Expect(2) = 7e-04 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPP 127 Score = 32.7 bits (71), Expect = 0.53 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPP 128 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPP 126 Score = 28.3 bits (60), Expect(2) = 7e-04 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 95 PPPPYGVNSSQPPPPPPPPP 114 Score = 26.2 bits (55), Expect(2) = 1.5 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +3 Query: 465 PPPLXXXXXFFFXEXPPPXGGXKXPPPXXXXXIXFFXXFFYKKXRXPPPXXFXSXXP 635 PPP F PPP G PPP F ++ PPP + P Sbjct: 42 PPPQGAPPPFLAPPPPPPPG----PPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPP 94 Score = 24.2 bits (50), Expect(2) = 4.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 108 PPPPPPPSPPPSAPPPPPPP 127 Score = 24.2 bits (50), Expect(2) = 3.4 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 109 PPPPPPSPPPSAPPPPPPPP 128 Score = 24.2 bits (50), Expect(2) = 3.4 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPPPPP--KXPXXXFLPPPXP 970 P PPPPP P L PP P Sbjct: 122 PPPPPPPTQPPPREAQLAPPPP 143 Score = 23.8 bits (49), Expect(2) = 4.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP + P P PP Sbjct: 123 PPPPPPTQPPPREAQLAPPPP 143 Score = 23.4 bits (48), Expect(2) = 1.5 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPP 815 P PPPP PPPP Sbjct: 122 PPPPPPPTQPPPREAQLAPPPP 143 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 36.3 bits (80), Expect(2) = 0.001 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP P GGG Sbjct: 50 PRPPPPPPPPTQPAPPPPPPARSGGG 75 Score = 24.2 bits (50), Expect(2) = 0.001 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 39 PPPARHRAPSPPRPPPPPPP 58 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 33.1 bits (72), Expect(2) = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPPK P PPP PP G Sbjct: 353 PPPPPPPKGPS----PPPPPPPGG 372 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPPK P PPP PP Sbjct: 313 PPPPPPPK-PAAAAPPPPPPP 332 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPP 331 Score = 30.7 bits (66), Expect = 2.1 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP PPPPPP P PPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPP-PPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPG 371 Query: 941 XXXFLPPPXPPXXG 982 PPP PP G Sbjct: 372 GKKGGPPPPPPKGG 385 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPP GG PPPPP Sbjct: 361 GPSPPPPPPPGGKKGGPPPPPP 382 Score = 25.8 bits (54), Expect(2) = 0.004 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPP 820 K A PPP PPPPPP Sbjct: 333 KAAPPPPPPKGPPPPPPAKGPPPPPP 358 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP PPPPPP + P PPPPP P Sbjct: 572 PPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVP---PPPPPPPPLP 628 Query: 941 XXXFLPPPXPP 973 LPPP PP Sbjct: 629 NHSVLPPPPPP 639 Score = 37.1 bits (82), Expect = 0.025 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 3/74 (4%) Frame = +2 Query: 761 PPPXXGXG---GXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPP 931 PPP G PPPPPP + P PPPPP Sbjct: 551 PPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Query: 932 KXPXXXFLPPPXPP 973 P PPP PP Sbjct: 611 ILPNRSVPPPPPPP 624 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPPPPP P PPPPP P Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPP-PPPPPPPPSLP 646 Query: 941 XXXFLPPPXP 970 PPP P Sbjct: 647 NRLVPPPPAP 656 Score = 33.5 bits (73), Expect = 0.30 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP F PPP PP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPP 568 Score = 33.1 bits (72), Expect = 0.40 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 P P PPPPPP F P PPPPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPL 594 Query: 941 XXXFLPPPXPP 973 +P P PP Sbjct: 595 PNCLVPSPPPP 605 Score = 33.1 bits (72), Expect = 0.40 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G +F PPPPP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPP 567 Score = 31.1 bits (67), Expect = 1.6 Identities = 21/78 (26%), Positives = 22/78 (28%), Gaps = 3/78 (3%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXS---FXPPPPPXXFFXFXFYXXXXXXXXXXXXXXXXXXXXXPXXP 920 P PPPP G S PPPPP + P P Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPP 606 Query: 921 PPPQXXRGXFFSXPPXPP 974 PPP PP PP Sbjct: 607 PPPPILPNRSVPPPPPPP 624 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G G PPPPP Sbjct: 651 PPPPAPGIGNKFPAPPPPPP 670 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G G PPPPPP Sbjct: 652 PPPAPGIGNKFPAPPPPPPP 671 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP+ P PP PP G Sbjct: 765 PPPPPQAPKPPGTVPPPPPLHG 786 >07_01_0080 + 587674-588510 Length = 278 Score = 32.7 bits (71), Expect = 0.53 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GG G + P PPPPP G P P Sbjct: 83 GGDGMFRRPPPPPPPPPSSGSPPP 106 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPP 973 F PPPPP P PPP PP Sbjct: 88 FRRPPPPPPPPPSSGSPPPPPPP 110 Score = 29.5 bits (63), Expect(2) = 0.019 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 104 PPPPPPPPPPPP---PPPPPP 121 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 G G + P PPPPP G P P Sbjct: 84 GDGMFRRPPPPPPPPPSSGSPPPP 107 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G PPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPP 113 Score = 29.1 bits (62), Expect(2) = 0.070 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPP 112 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 93 PPPPPPPSSGSPPPPPPPPPP 113 Score = 27.1 bits (57), Expect(2) = 0.019 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G G PPPPPP Sbjct: 79 PPRLGGDGMFRRPPPPPPP 97 Score = 25.4 bits (53), Expect(2) = 0.070 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPPPP Sbjct: 79 PPRLGGDGMFRRPPPPPPPP 98 >03_05_0161 + 21400580-21401695 Length = 371 Score = 28.3 bits (60), Expect(2) = 0.024 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 767 PXXGXGGXXVXXPPPPPP 820 P G GG PPPPPP Sbjct: 12 PRKGAGGGGTTTPPPPPP 29 Score = 27.9 bits (59), Expect(2) = 0.024 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPP + LPPP P G Sbjct: 24 PPPPPPAQQQQQQPLPPPPPQEQG 47 Score = 25.8 bits (54), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 G GGG PPPPP Sbjct: 15 GAGGGGTTTPPPPPP 29 Score = 21.4 bits (43), Expect(2) = 7.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 Query: 794 PXPPPPPXXGG 762 P PPPPP G Sbjct: 37 PLPPPPPQEQG 47 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 34.7 bits (76), Expect(2) = 0.028 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 434 PPPPPPPPPPLPPNMPPPLPP 454 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 425 PPPPPLPPPPPPPPPPPPP 443 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 429 PLPPPPPPPPPP---PPPLPP 446 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LPP PP Sbjct: 432 PPPPPPPPPPPPLPPNMPP 450 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 431 PPPPPP 436 Score = 21.0 bits (42), Expect(2) = 0.028 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 433 PPPPPP 438 >09_06_0125 - 21011757-21012428 Length = 223 Score = 36.7 bits (81), Expect = 0.033 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P P PPP P FL PP PP G G Sbjct: 167 PPPSPPPPPPRAPFLAPPPPPPVGSG 192 Score = 32.3 bits (70), Expect = 0.70 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGG 986 P PPP R F + PP PP G G Sbjct: 167 PPPSPPPPPPRAPFLAPPPPPPVGSG 192 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.5 bits (73), Expect(2) = 0.065 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP G Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKG 383 Score = 32.7 bits (71), Expect = 0.53 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPP 378 Score = 32.3 bits (70), Expect = 0.70 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPP 374 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPP 371 Score = 29.9 bits (64), Expect(2) = 0.14 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 370 PPRPPPPPPPIKKGAPPPAPP 390 Score = 23.4 bits (48), Expect(2) = 0.14 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 359 PPPPPPPPPPPPPRPPPPPP 378 Score = 21.0 bits (42), Expect(2) = 0.065 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 358 PPPPPP 363 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPPK PPP PP Sbjct: 359 PPPPPPPKLNTAPKPPPPPPP 379 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 356 PPPPPPPPPPKLNTAPKPPPP 376 Score = 29.5 bits (63), Expect(2) = 0.11 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LP P P Sbjct: 375 PPPPPPPSVPSNNNLPKPAEP 395 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 358 PPPPPPPPKLNTAPKPPPPPP 378 Score = 24.2 bits (50), Expect(2) = 0.11 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 361 PPPPPKLNTAPKPPPPPPPP 380 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Frame = +2 Query: 911 PXPPPPPKXPXXXF------LPPPXPPXXG 982 P PPPPP P LPPP PP G Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPG 259 Score = 29.1 bits (62), Expect(2) = 0.11 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P LPPP PP Sbjct: 258 PGPPPREIVPGQTLLPPPPPP 278 Score = 24.6 bits (51), Expect(2) = 0.11 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P G + PPPPPP Sbjct: 237 PKPANIAGAPGLPLPPPPPP 256 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 26.6 bits (56), Expect(2) = 0.15 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 737 KXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 K A PPP G G PPP PP Sbjct: 90 KGHPAPTMPPPSSGSGHTLPSPPPPLPP 117 Score = 26.6 bits (56), Expect(2) = 0.15 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 P PPP P LPPP PP Sbjct: 109 PSPPPPLPP--LLPPPQPP 125 >01_07_0082 - 40965947-40967023 Length = 358 Score = 27.5 bits (58), Expect(2) = 0.15 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 265 PAQPPPPQAGYG-----YPPPPP 282 Score = 25.8 bits (54), Expect(2) = 0.15 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPPXGG 983 PPPPQ G + PP GG Sbjct: 279 PPPPQAGYGGGYGYPPQAGYGG 300 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.1 bits (62), Expect(2) = 0.16 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 911 PXPPPPPK--XPXXXFLPPPXPP 973 P PPPPP+ P PPP PP Sbjct: 87 PPPPPPPERAVPEAADTPPPPPP 109 Score = 24.2 bits (50), Expect(2) = 0.16 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 73 GSPPPPPAEATPPPPPPPPPP 93 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP 973 PPPPPP F F F P PPPPP P + PP P Sbjct: 289 PPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPP--PPPPPPPPPPSFPWPFPPLAP 343 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP 973 PP PPP F F F P PPPP P F P PP Sbjct: 252 PPSPPPPAFPFPL--PPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPP 306 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G FGGGGG G Sbjct: 22 GGGGGGRGNGGGGFGGGGGGG 42 >07_03_1140 - 24258627-24258849,24259967-24260089,24260200-24260921, 24260945-24261073,24261484-24261714 Length = 475 Score = 33.9 bits (74), Expect = 0.23 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 830 KKXXGGGGGXKXPXPPPPPXXGGGXP 753 ++ GGGGG P PPP GGG P Sbjct: 5 RRVAGGGGGSLWGPPQPPPSTGGGIP 30 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 33.5 bits (73), Expect = 0.30 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG S PPPPP Sbjct: 87 PPPPTSNDGGIESISPPPPP 106 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 27.9 bits (59), Expect(2) = 0.33 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPPK P +PPP Sbjct: 43 PPPPPPPKPPPT--VPPP 58 Score = 24.2 bits (50), Expect(2) = 0.33 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G + PPPPPP Sbjct: 30 PPVPPDPYGADLSPPPPPPP 49 >08_02_0839 + 21693348-21694853 Length = 501 Score = 33.1 bits (72), Expect = 0.40 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXP 970 + P PPPPP+ P PPP P Sbjct: 27 YLPPPPPPPQPPLLQLQPPPPP 48 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P L PP PP Sbjct: 30 PPPPPPQPPLLQLQPPPPP 48 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 32.7 bits (71), Expect = 0.53 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P FLP PP Sbjct: 55 PPPPPPPPAPFFPFLPDSAPP 75 Score = 28.7 bits (61), Expect(2) = 0.90 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 264 PPPPPPPPPP-----PPPMPP 279 Score = 21.8 bits (44), Expect(2) = 0.90 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 262 VRPPPPPPP 270 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 32.7 bits (71), Expect = 0.53 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 PP GG GGG G GGGGG G Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPG 196 Score = 32.3 bits (70), Expect = 0.70 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 2/82 (2%) Frame = -1 Query: 988 PPPPXGGXGGXEKXXPRXFWGGGGXXGKXXXXXXXXXXXXXXXXXXGX*KX--KXKKXXG 815 PP P GG GG PR GGGG G G + G Sbjct: 132 PPAPGGGGGGGA---PRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGG 188 Query: 814 GGGGXXDXXPPXPXXGGGGXPG 749 GGGG P GGGG G Sbjct: 189 GGGGGGPGRAPGGGGGGGGLGG 210 Score = 32.3 bits (70), Expect = 0.70 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 817 GGGGGXXDXXPPXPXXGGGGXPG 749 GGGGG PP P GGGG G Sbjct: 336 GGGGGAGGVFPPTPDLGGGGGGG 358 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGG G GGGGG G Sbjct: 186 PGGGGGGGGPGRAPGGGGGGGGLG 209 Score = 29.5 bits (63), Expect = 5.0 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = -1 Query: 982 PPXGGXGGXEKXXPRXFWGGGGXXGKXXXXXXXXXXXXXXXXXXGX*KXKXKKXXGGGGG 803 PP GG GG P GGGG G + GGG G Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGG-GGALARPPGGGRG 166 Query: 802 XXDXXPPXPXXGGGGXPG 749 PP GGGG PG Sbjct: 167 GALGRPPG-GGGGGGGPG 183 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 32.7 bits (71), Expect = 0.53 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPP-----PPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 PPP GG PPP PPP + P PP Sbjct: 4 PPPPTMNGGHHAAPPPPQVSGAPPPPHGHYQQQPPPQPYCQQQQPLPPHYYQAGPPHAPP 63 Query: 926 PPKXPXXXFLPPPXPP 973 P + P PPP PP Sbjct: 64 PQQPPAMWGQPPPPPP 79 >11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 Length = 515 Score = 32.3 bits (70), Expect = 0.70 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 1/79 (1%) Frame = -1 Query: 985 PPPXGGXGGXEKXXPRXFWGG-GGXXGKXXXXXXXXXXXXXXXXXXGX*KXKXKKXXGGG 809 PPP G GG +K G GG G G K K GG Sbjct: 244 PPPNAGGGGDKKGGNNGGGAGNGGKKGGGGNEIPVQIKGNANNAAGGGKKDSGAKQNQGG 303 Query: 808 GGXXDXXPPXPXXGGGGXP 752 GG P GGGG P Sbjct: 304 GGKNGGGQPNNAKGGGGAP 322 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 32.3 bits (70), Expect = 0.70 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 763 PPXXGGGGGXGXFXPPPPP 819 P GGGGG G PPPPP Sbjct: 31 PSCGGGGGGAGPTPPPPPP 49 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGGG P PPPPP Sbjct: 34 GGGGGGAGPTPPPPP 48 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 760 PPPXXGGGGGXGXFXPPPPP 819 P P GGGGG PPPPP Sbjct: 29 PIPSCGGGGGGAGPTPPPPP 48 Score = 29.1 bits (62), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGG P PPPPP Sbjct: 36 GGGGAGPTPPPPPPP 50 Score = 29.1 bits (62), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGG G P PPPPP Sbjct: 37 GGGAGPTPPPPPPPP 51 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P G GG PPPPPP Sbjct: 31 PSCGGGGGGAGPTPPPPPPP 50 Score = 22.6 bits (46), Expect(2) = 3.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 42 PTPPPPPPPP 51 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 32.3 bits (70), Expect = 0.70 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 + P PPPP P PPP P GGG Sbjct: 54 YYPPPPPPVVTPTPQCPPPPSYPSGGGG 81 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGG 759 GGGGG PPPP GGG Sbjct: 82 GGGGGTVMYTSPPPPYSGGG 101 Score = 29.9 bits (64), Expect = 3.7 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -2 Query: 987 PPPXXGGXGGGRKXXXGXFGGGGG 916 PPP GG GGG G GGGGG Sbjct: 114 PPPTGGGGGGGGGWQQG--GGGGG 135 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 5/31 (16%) Frame = -2 Query: 987 PPPXXGGXGGGRKXXXGXF-----GGGGGXG 910 PPP GG GG G + GGGGG G Sbjct: 94 PPPYSGGGGGSSTGGGGIYYPPPTGGGGGGG 124 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 818 GGGGGXKXPXPPPP 777 GGGGG P PPPP Sbjct: 130 GGGGGGAYPTPPPP 143 >01_01_0046 - 331758-332627 Length = 289 Score = 29.9 bits (64), Expect(2) = 0.75 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 23 PPPPPPPPPPSSSRYRPPSPP 43 Score = 21.0 bits (42), Expect(2) = 0.75 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 22 PPPPPP 27 >10_08_0115 + 14924463-14924939 Length = 158 Score = 29.5 bits (63), Expect(2) = 0.79 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PPP G + PPPPPP Sbjct: 87 ATATPPPEDVAGDDMIDAPPPPPP 110 Score = 21.4 bits (43), Expect(2) = 0.79 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP + + PP P Sbjct: 107 PPPPPPMEVQLGADVLPPQP 126 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 911 PXPPP---PPKXPXXXFLPPPXPP 973 P PPP PP P LPPP PP Sbjct: 1162 PSPPPATPPPPPPLSPSLPPPPPP 1185 Score = 28.7 bits (61), Expect(2) = 0.86 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPP P P PPP PP Sbjct: 1192 PPPQPAPPPLPIQPPPIPP 1210 Score = 21.8 bits (44), Expect(2) = 0.86 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP + PPPPPP Sbjct: 1169 PPPPPPLSPSLPPPPPPPP 1187 >06_03_1178 + 28203466-28204590,28204745-28205652,28206189-28206258 Length = 700 Score = 25.8 bits (54), Expect(2) = 0.91 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G GG PPPPPP Sbjct: 233 GVGGPEFLPPPPPPP 247 Score = 24.6 bits (51), Expect(2) = 0.91 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 905 FXPXPPPPPKXP 940 F P PPPPP P Sbjct: 239 FLPPPPPPPPTP 250 >07_03_1788 + 29523216-29524867,29525048-29525075 Length = 559 Score = 27.1 bits (57), Expect(2) = 0.92 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G G PPPPPP Sbjct: 18 PPKRGRGRPRKNPPPPPPP 36 Score = 23.4 bits (48), Expect(2) = 0.92 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P P PP G Sbjct: 30 PPPPPPPATD-----PNPHPPSGAG 49 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.9 bits (69), Expect = 0.93 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP+ P PPP PP GG Sbjct: 614 PPPPPRPPGAP--PPPPPPGKPGG 635 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPP P PPP PP G Sbjct: 621 PGAPPPPPPPGKPGGPPPPPPRPG 644 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 624 PPPPPPPGKPGGPPPP 639 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 31.9 bits (69), Expect = 0.93 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 760 PPPXXGGGGGXGXFXPPPPP 819 PPP GGGG G F PPP Sbjct: 18 PPPPQAGGGGGGEFYRGPPP 37 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G GG F PPP Sbjct: 15 PQHPPPPQAGGGGGGEFYRGPPP 37 Score = 29.1 bits (62), Expect(2) = 1.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP+ P PPP GGG Sbjct: 9 PPPPPPPQHP-----PPPQAGGGGGG 29 Score = 21.0 bits (42), Expect(2) = 1.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 8 PPPPPP 13 >01_01_0570 - 4231100-4232560 Length = 486 Score = 31.9 bits (69), Expect = 0.93 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGGGG G Sbjct: 101 GGLGGGGMGGSGGFGGGGGGG 121 Score = 31.9 bits (69), Expect = 0.93 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGGGG G Sbjct: 277 GGGGGGGMGGGGGFGGGGGVG 297 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 180 GGVGGGGRFGGGGMGGGGGFG 200 >01_01_0083 + 631196-631675 Length = 159 Score = 31.9 bits (69), Expect = 0.93 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 763 PPXXGGGGGXGXFXPPPPP 819 PP GGGGG G P PPP Sbjct: 93 PPAGGGGGGGGFNYPAPPP 111 Score = 30.3 bits (65), Expect = 2.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 760 PPPXXGGGGGXGXFXPPPPP 819 PP GGGGG + PPPP Sbjct: 93 PPAGGGGGGGGFNYPAPPPP 112 Score = 29.1 bits (62), Expect = 6.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 818 GGGGGXKXPXPPPP 777 GGGGG P PPPP Sbjct: 99 GGGGGFNYPAPPPP 112 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 28.7 bits (61), Expect(2) = 0.95 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP FLPPP P Sbjct: 144 PPPPPPMAVAPPPFLPPPLRP 164 Score = 21.8 bits (44), Expect(2) = 0.95 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G PPPPPP Sbjct: 138 GATAPPPPPPPP 149 >05_01_0380 + 2978256-2979284 Length = 342 Score = 28.7 bits (61), Expect(2) = 0.96 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 26 PPPPPPPPPP-----PPPPPP 41 Score = 26.6 bits (56), Expect(2) = 5.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P F P P Sbjct: 31 PPPPPPPPPPPRPFSRKPSEP 51 Score = 21.8 bits (44), Expect(2) = 0.96 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 23 VRMPPPPPP 31 Score = 21.0 bits (42), Expect(2) = 5.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 27 PPPPPP 32 >01_01_0895 + 7052118-7053110,7053249-7053252,7054450-7055189 Length = 578 Score = 28.3 bits (60), Expect(2) = 1.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP G GG + PP PP Sbjct: 35 PPPPCGDGGRRLPLPPSPP 53 Score = 21.8 bits (44), Expect(2) = 1.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP 958 P PP PP P LP Sbjct: 47 PLPPSPPGVPLLGHLP 62 >06_03_1363 - 29576265-29577575 Length = 436 Score = 28.3 bits (60), Expect(2) = 1.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PP PP Sbjct: 390 PPPPPPPAARRESWAAPPPPP 410 Score = 21.8 bits (44), Expect(2) = 1.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 388 VTPPPPPPP 396 >09_04_0580 + 18681019-18681475,18682637-18682920,18683088-18683315, 18683415-18683864 Length = 472 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXGXK 904 P GG GGG G GGGGG G K Sbjct: 99 PHSGGGGGGGGGGGGGGGGGGGGGNK 124 >07_03_0560 + 19479597-19480667 Length = 356 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGGGG G Sbjct: 74 GGGGGGGLGGGGGFGGGGGAG 94 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 111 GGVGGGGGGEGGGLGGGGGGG 131 >07_03_0177 - 14770777-14772045 Length = 422 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGGGG G Sbjct: 365 GGLGGGGGGGGGGFGGGGGSG 385 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGGGG G Sbjct: 72 GGGGGGGFGGGGGFGGGGGGG 92 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 760 PPPXXGGGGGXGXFXPPPP 816 P P GGGGG G PPPP Sbjct: 85 PSPYYGGGGGYGKPPPPPP 103 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 355 PAPPPPP--PFAPTLPPPPPP 373 Score = 26.6 bits (56), Expect(2) = 2.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP PPP PP Sbjct: 412 PPPPPTHTHGPPPPPPPPP 430 Score = 22.2 bits (45), Expect(2) = 2.5 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PP PPPPPP Sbjct: 352 GQPPAPPPPPPFAPTLPPPPPP 373 >01_05_0423 + 22032940-22033695 Length = 251 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 905 FXPXPPPPPK-XPXXXFLPPPXP 970 F P PPPPP+ FLPPP P Sbjct: 164 FLPSPPPPPQGQQQLLFLPPPPP 186 >01_02_0031 + 10364487-10365407 Length = 306 Score = 27.5 bits (58), Expect(2) = 1.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP P Sbjct: 169 PPPPPPPPALPAPPPPPAP 187 Score = 22.6 bits (46), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G V PPPPPP Sbjct: 164 GQVLVPPPPPPPP 176 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 27.1 bits (57), Expect(2) = 4.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP + PPP PP Sbjct: 333 PPPPPPSRFNNTTPKPPPPPP 353 Score = 25.4 bits (53), Expect(2) = 1.5 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 334 PPPPPSRFNNTTPKPPPPPP 353 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 346 PKPPPPP--------PPPEPP 358 Score = 21.0 bits (42), Expect(2) = 4.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 331 PPPPPP 336 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 27.5 bits (58), Expect(2) = 1.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PP PP Sbjct: 78 PPPPPPPPPRNSPSPPKPP 96 Score = 22.2 bits (45), Expect(2) = 1.5 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 64 PPLPSATPPLAASPPPPPP 82 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.3 bits (60), Expect(2) = 1.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 159 PPPPPPPPAPVAAAVSAPAPP 179 Score = 21.4 bits (43), Expect(2) = 1.6 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 148 PPPPPPQESTPPPPPPPPP 166 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 28 PPPPPSDP-----PPPPPP 41 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP V PPPPPP Sbjct: 15 PPPFSSR--PRVVGPPPPPP 32 >06_03_0704 + 23706318-23707024,23707093-23707222 Length = 278 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGRK G GG GG G Sbjct: 124 GGGGGGRKVCNGGGGGSGGKG 144 >02_05_0407 + 28715332-28715385,28715528-28715680,28715810-28715872, 28715988-28716021,28716157-28716279,28716400-28716462, 28716655-28716748,28717049-28717094,28717180-28717247, 28717360-28717408,28717593-28717658,28718876-28719074, 28719344-28719386,28719719-28719923 Length = 419 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXGXK 904 P G GGG + G GGGGG G K Sbjct: 16 PFSNGGGGGARRGGGGGGGGGGGGGK 41 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXGXKXXS 895 P GG GG R+ G GGGGG G S Sbjct: 16 PFSNGGGGGARRGGGGGGGGGGGGGKSQFS 45 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 27.9 bits (59), Expect(2) = 1.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 P PP P PPP PP GG Sbjct: 175 PSPPVPAPAPAGSPPPPPPPPAGG 198 Score = 21.8 bits (44), Expect(2) = 1.7 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP P PPPP Sbjct: 145 PPPPPTVPAAPTPRPSPPPP 164 >04_01_0034 - 401208-402923 Length = 571 Score = 25.0 bits (52), Expect(2) = 2.0 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P PP Sbjct: 322 PPPPPPPLDPPPRAAAPP 339 Score = 24.2 bits (50), Expect(2) = 2.0 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 309 PPPPQQQRAKPSRPPPPPPP 328 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 27.1 bits (57), Expect(2) = 2.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP LPPP PP Sbjct: 215 PTPPPPPLALP---LPPPPPP 232 Score = 22.2 bits (45), Expect(2) = 2.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 GG + PPPPP Sbjct: 209 GGATIAPTPPPPP 221 >02_05_1277 - 35408097-35409080 Length = 327 Score = 28.3 bits (60), Expect(2) = 2.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P P P PP Sbjct: 63 PPPPPAQPPVLAAPAPAPP 81 Score = 21.0 bits (42), Expect(2) = 2.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 62 PPPPPP 67 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 27.5 bits (58), Expect(2) = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 127 PPPPPPHPLPP--PPPTPP 143 Score = 21.8 bits (44), Expect(2) = 2.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 124 VESPPPPPP 132 >12_02_0617 + 21256745-21256943,21257454-21257647,21257836-21258042, 21258115-21258232,21258325-21258401,21258513-21258692, 21259312-21259356,21260309-21260413,21261115-21261261 Length = 423 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP+ P FLPP P Sbjct: 15 PARPPPPRLPLPRFLPPTPP 34 >12_01_0454 + 3580332-3581714 Length = 460 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 988 PPPPXGGXGGXEKXXPRXFWGGGG 917 PPPP G ++ P WGGGG Sbjct: 374 PPPPTSGRRRHKQEEPEFTWGGGG 397 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPP P PPP PP G Sbjct: 926 PGAPPPPPPPGKPGGPPPPPPPPG 949 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGGG 988 PPPP+ P PPP PP GG Sbjct: 920 PPPPRPPGAP--PPPPPPGKPGG 940 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 929 PPPPPPPGKPGGPPPP 944 >08_02_1256 + 25645085-25645396 Length = 103 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 >08_02_1019 - 23657175-23658047 Length = 290 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGG G GGGGG G Sbjct: 30 PGLGGGGGGVPKPGGGVGGGGGGG 53 >06_03_1310 + 29238644-29240260 Length = 538 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP P LPPP P Sbjct: 395 PPTPPPPSSPTPSHLPPPPP 414 >06_03_0790 - 24636805-24637770 Length = 321 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGG 135 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGG 134 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 30.7 bits (66), Expect = 2.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPP 961 F P PPPPP+ P + PP Sbjct: 171 FAPPPPPPPRPPAPEYKPP 189 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGG 759 GGGG P PPPPP G Sbjct: 211 GGGGHPHPPPPPPPPPSAG 229 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGG 762 GGGG P PPPPP G Sbjct: 211 GGGGHPHPPPPPPPPPSAG 229 Score = 27.9 bits (59), Expect(2) = 3.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 734 KKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 +K K P G GG PPPPPP Sbjct: 197 EKKKRKKPQPADTSGGGGHPHPPPPPPPP 225 Score = 20.6 bits (41), Expect(2) = 3.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 911 PXPPPPP 931 P PPPPP Sbjct: 220 PPPPPPP 226 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 58 GGGGGGRGGGGGGGGGGGGGG 78 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 57 GGGGGGGRGGGGGGGGGGGGG 77 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 28.3 bits (60), Expect(2) = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P F+P P Sbjct: 45 PPPPPPPPPPTLVFVPVTSP 64 Score = 21.0 bits (42), Expect(2) = 2.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 43 PPPPPP 48 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP GG Sbjct: 82 PPPPPPPPPTNGTLTPPPSSAPSGG 106 Score = 27.9 bits (59), Expect(2) = 2.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P L PP GG Sbjct: 83 PPPPPPPPTNGTLTPPPSSAPSGG 106 Score = 21.0 bits (42), Expect(2) = 2.6 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 82 PPPPPP 87 >07_03_1090 + 23891294-23892222,23892317-23892516,23895241-23895482, 23895771-23896461,23896486-23896562 Length = 712 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP+ LP PP Sbjct: 225 PPPPPPPRQRLLRPLPAESPP 245 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P V PPPPPP Sbjct: 211 PAPPQTNPPRPVRPPPPPPP 230 >12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561, 9769918-9769980,9770547-9771325 Length = 665 Score = 26.6 bits (56), Expect(2) = 2.6 Identities = 12/41 (29%), Positives = 13/41 (31%) Frame = +2 Query: 698 RKXXPFFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 R P +K PPP PPPPPP Sbjct: 3 RSTFPLVSHLPSRKPPPIRPRPPPVRPYASSAASPPPPPPP 43 Score = 22.2 bits (45), Expect(2) = 2.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP 958 P PPPPP LP Sbjct: 37 PPPPPPPPASAYVHLP 52 >09_04_0093 - 14550806-14552452 Length = 548 Score = 25.0 bits (52), Expect(2) = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P LPP P Sbjct: 13 PPPPPPPGHPPN--LPPHVP 30 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 767 PXXGXGGXXVXXPPPPPP 820 P G G PPPPPP Sbjct: 2 PRDGDGHGRRRPPPPPPP 19 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 27.5 bits (58), Expect(2) = 2.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPP 964 + P PPPPP P LP P Sbjct: 426 YAPPPPPPPPPPPPQALPLP 445 Score = 21.4 bits (43), Expect(2) = 2.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G PPPPPP Sbjct: 423 GPPYAPPPPPPP 434 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 27.9 bits (59), Expect(2) = 2.7 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 911 PXPPPPP--KXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 10 PPPPPPPSESTPTSDPKPPPPPP 32 Score = 21.0 bits (42), Expect(2) = 2.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 9 PPPPPP 14 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 27.9 bits (59), Expect(2) = 2.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 197 PPPPPAAP-----PPPPPPARG 213 Score = 21.0 bits (42), Expect(2) = 2.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 196 PPPPPP 201 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 27.9 bits (59), Expect(2) = 2.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 81 PPPPPPPSPPATHDVGQPPPP 101 Score = 21.0 bits (42), Expect(2) = 2.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 77 PPPPPP 82 >10_05_0028 - 8311041-8311709,8312175-8312478,8314768-8314841 Length = 348 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G +GGGGG G Sbjct: 146 GGYGGGGYSGQGTYGGGGGYG 166 >08_02_1063 + 24024030-24024506,24024803-24024856,24024965-24025118, 24025314-24025388,24025511-24025788,24026023-24026253, 24026522-24026620,24026740-24026889,24027830-24027976, 24028525-24028575,24028647-24028819,24029018-24029147, 24029361-24029458,24029655-24029892,24030634-24030837, 24031003-24031083,24031296-24031535 Length = 959 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXGXK 904 PP GG GGG G GGGGG G K Sbjct: 109 PPRGGGGGGG---GDGGGGGGGGGGWK 132 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G +GGGGG G Sbjct: 151 GGYGGGGYPGGGYYGGGGGGG 171 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G +GGGGG G Sbjct: 138 GGYGGGGYPGGGYYGGGGGGG 158 >06_01_0096 - 794148-794246,795682-796975,798960-799417 Length = 616 Score = 30.3 bits (65), Expect = 2.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGG K G GG GG G Sbjct: 35 PKNGGNGGGGKNGGGNGGGNGGAG 58 >05_01_0137 + 917533-917814,918080-918352 Length = 184 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 5/29 (17%) Frame = +2 Query: 917 PPPPPKXPXXXFL-----PPPXPPXXGGG 988 PPPPP F PPP PP GGG Sbjct: 69 PPPPPSFRRRSFCRRCTPPPPPPPAAGGG 97 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 30.3 bits (65), Expect = 2.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 Score = 27.1 bits (57), Expect(2) = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 49 PAPPPPPHRPSPS--PPPNP 66 Score = 21.0 bits (42), Expect(2) = 4.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 38 PPPPPP 43 >04_04_0360 - 24684159-24684565,24684654-24685089 Length = 280 Score = 30.3 bits (65), Expect = 2.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXGXKXXS 895 P GG GGG G GGGGG G S Sbjct: 53 PCYGGGGGGGGGGGGGGGGGGGSGVSVES 81 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 30.3 bits (65), Expect = 2.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G +GGGGG G Sbjct: 114 GGGGGGYGRREGGYGGGGGYG 134 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G +GGGGG G Sbjct: 101 GGYGGGR--GGGGYGGGGGGG 119 >01_07_0122 - 41196081-41196205,41197561-41198245,41198961-41199329, 41199405-41199514,41200539-41200833 Length = 527 Score = 30.3 bits (65), Expect = 2.8 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 987 PPPXXGGXGGGRKXXXGXFGGGGGXG 910 PP GG GGGR G GGGGG G Sbjct: 16 PPDGAGGGGGGR----GGRGGGGGRG 37 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 PP G GGG + G GG GG G Sbjct: 16 PPDGAGGGGGGRGGRGGGGGRGGSG 40 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 26.2 bits (55), Expect(2) = 2.8 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPP 820 K A PP G PPPPPP Sbjct: 144 KAAARLGPPPCGDANENPPPPPPPPP 169 Score = 22.6 bits (46), Expect(2) = 2.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 161 PPPPPPPPPP 170 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 27.5 bits (58), Expect(2) = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 921 PPPQXXRGXFFSXPPXPPXGGGG 989 PPP G PP PP GG G Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLG 1131 Score = 21.0 bits (42), Expect(2) = 3.1 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 762 PPPXXGXGGXXSFXPPPP 815 PPP G PPPP Sbjct: 1085 PPPLPPTLGDYGVAPPPP 1102 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.9 bits (64), Expect = 3.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 830 KKXXGGGGGXKXPXPPPPP 774 ++ GGGG + P PPPPP Sbjct: 89 RRGVGGGGWVQLPPPPPPP 107 Score = 25.8 bits (54), Expect(2) = 3.3 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 GG V PPPPPP Sbjct: 94 GGGWVQLPPPPPP 106 Score = 22.6 bits (46), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 101 PPPPPPPPPP 110 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 26.2 bits (55), Expect(2) = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P LPPP P Sbjct: 238 PPPPPPPPP---LPPPMP 252 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G V PPPPPP Sbjct: 232 GCSSVRPPPPPPP 244 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 119 PPPPPPPHPPED---PPPHPP 136 Score = 27.5 bits (58), Expect(2) = 3.4 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +2 Query: 911 PXPP--PPPKXPXXXFLPPPXPP 973 P PP PPP P PPP PP Sbjct: 125 PHPPEDPPPHPPHPPDHPPPPPP 147 Score = 21.0 bits (42), Expect(2) = 3.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 120 PPPPPP 125 >03_02_0738 - 10824121-10825572 Length = 483 Score = 25.4 bits (53), Expect(2) = 3.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP 958 P PPPPP P LP Sbjct: 94 PPPPPPPSSPPPPALP 109 Score = 23.0 bits (47), Expect(2) = 3.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP + PPPPPP Sbjct: 80 PPSPPSSSPPPLSFPPPPPP 99 >02_04_0289 + 21615745-21616155,21617417-21617870,21618162-21618217, 21618307-21618437,21618565-21618727 Length = 404 Score = 25.0 bits (52), Expect(2) = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXF 826 PPP G PPPPPP F Sbjct: 54 PPPH----GMVAAAPPPPPPQF 71 Score = 23.4 bits (48), Expect(2) = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%), Gaps = 4/23 (17%) Frame = +2 Query: 917 PPPPPKXPXXXFLPP----PXPP 973 PPPPP F PP P PP Sbjct: 64 PPPPPPQFVKHFAPPASVTPPPP 86 >06_01_0744 + 5565939-5566249,5566383-5566476,5569067-5569124, 5569214-5569257,5569366-5569539 Length = 226 Score = 22.6 bits (46), Expect(3) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 905 FXPXPPPPP 931 F P PPPPP Sbjct: 40 FLPPPPPPP 48 Score = 22.2 bits (45), Expect(3) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 43 PPPPPPPLVP 52 Score = 21.8 bits (44), Expect(3) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 39 VFLPPPPPP 47 >04_03_1022 - 21778315-21779007 Length = 230 Score = 27.5 bits (58), Expect(2) = 3.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P P P P Sbjct: 40 PPPPPPPYVPPHLLPPSPAP 59 Score = 21.0 bits (42), Expect(2) = 3.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 36 PPPPPP 41 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXGXK 904 PP GG G G FGGGGG G + Sbjct: 3 PPRGGGGGRFGGGGGGRFGGGGGRGGR 29 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 817 GGGGGXXDXXPPXPXXGGGGXPG 749 GGGGG + P P GGGG G Sbjct: 17 GGGGGGGEGLNPNPSGGGGGGGG 39 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G + PPPPP Sbjct: 183 GPPPPPPPQPSGDANENPPPPP 204 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.9 bits (64), Expect = 3.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP+ P PPP PP Sbjct: 396 PAPPPPPQPPP----PPPPPP 412 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 265 PRPPPPQVPPPPPQAPPPPPP 285 Score = 25.0 bits (52), Expect(2) = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PP PP GG Sbjct: 305 PPPPPPPLANGPPRSIPP-PPMTGG 328 Score = 23.0 bits (47), Expect(2) = 4.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 296 PPPPVGG----TQPPPPPPP 311 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP F PPP PP Sbjct: 108 PYRPPPPPRKKPQFQPPPQPP 128 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P L PP P Sbjct: 133 PSPPPPPPAPAAPVLVPPPAP 153 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.9 bits (64), Expect = 3.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXG 795 G G PPP GGGGG G Sbjct: 392 GPGAPPPYHGGGGGGG 407 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 24.2 bits (50), Expect(2) = 4.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 585 PPPEPSPPPAPKAAPPPPPP 604 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPP P PP P G Sbjct: 611 PPRPPPPAMPGSSKTRPPPPLKPG 634 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P P P Sbjct: 553 PPPPPPPPAPAPALAPAP 570 Score = 21.8 bits (44), Expect(2) = 4.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 542 GEEGLVGPPPPPPPP 556 >12_01_0442 + 3495333-3496484 Length = 383 Score = 22.6 bits (46), Expect(3) = 4.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 905 FXPXPPPPP 931 F P PPPPP Sbjct: 68 FRPPPPPPP 76 Score = 21.8 bits (44), Expect(3) = 4.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 67 VFRPPPPPP 75 Score = 21.8 bits (44), Expect(3) = 4.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPP K P Sbjct: 73 PPPPPPAKNP 82 >06_03_0082 + 16363742-16364632 Length = 296 Score = 25.4 bits (53), Expect(2) = 4.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 782 GGXXVXXPPPPPPXF 826 GG PPPPPP F Sbjct: 163 GGGEERPPPPPPPPF 177 Score = 22.6 bits (46), Expect(2) = 4.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 169 PPPPPPPPFP 178 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG G G++ G +GGGGG G Sbjct: 93 GGGGYGQRGGGGGYGGGGGYG 113 >05_05_0135 - 22626163-22626198,22626391-22626441,22626516-22626608, 22627249-22627254,22628051-22628180,22628333-22628583 Length = 188 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 988 PPPPXGGXGGXEKXXPRXFWGGGGXXG 908 P P GG G E PR GGGG G Sbjct: 5 PGSPGGGGGSHESGSPRGGGGGGGGGG 31 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 911 PXPPPPP---KXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPP 94 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PP PP P PPP PP Sbjct: 84 PPPPLPPPPPPPAASPPPPPP 104 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 87 PLPPPPPPPAASPPPPPPSPP 107 >01_06_1792 - 39912714-39913559 Length = 281 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGG 759 GGGG P PPPP G G Sbjct: 180 GGGGTGWPVPPPPQDGGSG 198 >01_06_1365 - 36690267-36692222 Length = 651 Score = 29.5 bits (63), Expect = 5.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXGXK 904 P GG GGG + G GGGGG K Sbjct: 607 PMRSGGGGGGARRGGGGGGGGGGLPAK 633 >01_01_0929 - 7344911-7345978 Length = 355 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PP PP P PPP PP Sbjct: 18 PTPPLPPSPPSKTRRPPPPPP 38 Score = 28.7 bits (61), Expect = 8.7 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Frame = +2 Query: 911 PXPPPPPKXPXXXF------LPPPXPPXXG 982 P PPPPP P LPPP PP G Sbjct: 33 PPPPPPPFCPHLSVPCVGLPLPPPCPPPPG 62 >02_04_0001 - 18816492-18816741,18816881-18817050,18817244-18817388, 18817495-18817565,18817910-18817993,18818103-18818222, 18818310-18818480,18818955-18819044,18821893-18821985, 18822073-18822405 Length = 508 Score = 27.1 bits (57), Expect(2) = 5.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P G G PPPPPP Sbjct: 36 PAPPEGAGDVSPPSPPPPPP 55 Score = 20.6 bits (41), Expect(2) = 5.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 911 PXPPPPP 931 P PPPPP Sbjct: 50 PPPPPPP 56 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 25.8 bits (54), Expect(2) = 5.9 Identities = 12/29 (41%), Positives = 13/29 (44%), Gaps = 8/29 (27%) Frame = +2 Query: 911 PXPPPPPKXPXXXFL--------PPPXPP 973 P PPPPP P + PPP PP Sbjct: 355 PPPPPPPPPPPPVYYSSYVMLDRPPPPPP 383 Score = 21.8 bits (44), Expect(2) = 5.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 354 VPPPPPPPP 362 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 26.2 bits (55), Expect(2) = 5.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 18 PPPPPPPP-----PPPLPP 31 Score = 21.4 bits (43), Expect(2) = 5.9 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G PPPPPP Sbjct: 9 GAAAAAAAAPPPPPP 23 >12_02_1274 - 27480012-27480383 Length = 123 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = -1 Query: 817 GGGGGXXDXX---PPXPXXGGGGXPG 749 GGGGG D PP P GGGG G Sbjct: 49 GGGGGLNDHKTFLPPVPGMGGGGVGG 74 >11_01_0422 + 3246528-3248606 Length = 692 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXFXPPPPP 819 G P GGGGG G PPP P Sbjct: 221 GDPASDGGGGGGGGGDTPPPFP 242 >10_01_0026 - 351737-353443 Length = 568 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 710 PFFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 PFF + G PP G PPPPPP Sbjct: 141 PFFTDEKGNVYYATGGLPPMWQQHGSSNYSIPPPPPP 177 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXG 982 F PPPPP P PPP PP G Sbjct: 49 FGAHPPPPPPPP-----PPPPPPPRG 69 >08_01_0546 - 4746118-4746580,4747335-4747342 Length = 156 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 75 GGGGGGGEGGGGGGGGGGGGG 95 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 76 GGGGGGEGGGGGGGGGGGGGG 96 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 367 GGVGGGHGAGGGGAGGGGGFG 387 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG+ G FGGGGG G Sbjct: 291 GGFGGGK---GGGFGGGGGGG 308 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G FGGG G G Sbjct: 304 GGGGGGGAGAGGGFGGGKGGG 324 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP G G Sbjct: 34 PTPPPPPPRRRT---PPPPPPGSGPG 56 >07_03_0559 + 19475893-19476783 Length = 296 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 969 GXGGGRKXXXGXFGGGGGXG 910 G GGG G FGGGGG G Sbjct: 75 GGGGGGLGGGGGFGGGGGGG 94 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 198 GGGGGMGSGGGGGFGGGGGKG 218 >07_03_0558 + 19461369-19462448 Length = 359 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 124 GGGAGGGLGGGGGFGGGGGGG 144 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 162 GGGAGGGVGGGGGFGGGGGGG 182 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 198 GGGAGGGVGGGGGFGGGGGSG 218 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 302 GGGAGGGVGGGGGFGGGGGGG 322 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 338 GGGAGGGVGGGGGFGGGGGGG 358 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GG G FGGGGG G Sbjct: 230 GGGAGGGIGGGGGFGGGGGGG 250 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 763 PPXXGGGGGXGXFXPPPP 816 P GGGGG G PPPP Sbjct: 30 PRGAGGGGGGGGAVPPPP 47 >05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094, 4501219-4501296,4501333-4501557,4502842-4502910, 4502946-4503200 Length = 351 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -2 Query: 987 PPPXXG-GXGGGRKXXXGXFGGGGGXG 910 PP G G GGG + G GGGGG G Sbjct: 3 PPRGRGFGRGGGGRGDGGGRGGGGGRG 29 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPPPKXPXXXF-LPPPXPP 973 P PPP P+ P +PPP PP Sbjct: 73 PPPPPAPRPPRRHHRIPPPPPP 94 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP P G Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAG 344 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPP 815 PG PPP G G PPPP Sbjct: 366 PGPGPPPPPGAAGRGGGGPPPP 387 >03_01_0023 + 198414-198968 Length = 184 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGG G GGGGG G Sbjct: 35 PGGGGGGGGGGGGGGGGRGGGGGSG 59 >02_05_0149 + 26290236-26290880 Length = 214 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 969 GXGGGRKXXXGXFGGGGGXG 910 G GGG G FGGGGG G Sbjct: 118 GFGGGYGGHPGGFGGGGGGG 137 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 398 KGGGGXGKKFXXXXPXKKKXRXPPPP 475 +GGG GK+ P ++ R PPPP Sbjct: 11 RGGGTLGKRKERDRPSSEEQRAPPPP 36 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 G G P PPPPP G P P Sbjct: 80 GVGAWGAPSPPPPPAAAGAAPHP 102 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 G G PPPPP GG P P Sbjct: 13 GDGDSHPQQPPPPPPGGGAKPEP 35 >02_01_0789 - 5919271-5919411,5920105-5920215,5920303-5920401, 5920486-5920642,5920774-5920937,5921017-5921079, 5921153-5921377,5922038-5922135,5923283-5923499 Length = 424 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 Query: 987 PPPXXGGXGGGRKXXXGXFGGGGGXGXK 904 PPP GG G GGGGG G + Sbjct: 11 PPPAAGGDEAAAAKGRGGAGGGGGEGLR 38 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.1 bits (62), Expect = 6.5 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP 973 PPPPPP F L P PPPPP PP PP Sbjct: 609 PPPPPPPSSIFYNLFKKGGSKSRRIHSVAP------PQPPPPPPPTTRRSRKPPQPP 659 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 25.8 bits (54), Expect(2) = 7.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P +P P P Sbjct: 128 PPPPPPPPARTPMPTPTP 145 Score = 21.4 bits (43), Expect(2) = 7.1 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 126 ISPPPPPPP 134 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P +PP Sbjct: 77 PPPPPPPPPPPPVPVPP 93 Score = 21.4 bits (43), Expect(2) = 7.2 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 767 PXXGXGGXXVXXPPPPPP 820 P G PPPPPP Sbjct: 66 PPAGIAVHPSPPPPPPPP 83 >12_02_0859 - 23751198-23753258 Length = 686 Score = 25.0 bits (52), Expect(2) = 7.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 812 GGGXKXPXPPPPP 774 GG + P PPPPP Sbjct: 618 GGAAEVPEPPPPP 630 Score = 22.2 bits (45), Expect(2) = 7.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 794 PXPPPPPXXGGG 759 P PPPPP G Sbjct: 627 PPPPPPPPVSSG 638 >04_03_0057 + 10407402-10407452,10407540-10407782,10408506-10408976, 10409058-10409483,10409559-10409618,10409694-10409807, 10409888-10409956 Length = 477 Score = 24.6 bits (51), Expect(2) = 7.5 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P L P G Sbjct: 416 PPPPPPPSPPVQQTLSDRTPSATG 439 Score = 22.6 bits (46), Expect(2) = 7.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 905 FXPXPPPPP 931 F P PPPPP Sbjct: 412 FKPAPPPPP 420 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 25.4 bits (53), Expect(2) = 7.6 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P L P Sbjct: 43 PPPPPPPPAPAPALLAP 59 Score = 21.8 bits (44), Expect(2) = 7.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 36 VIAPPPPPP 44 >02_05_1251 - 35249550-35249814,35249962-35250347,35250489-35250578, 35250672-35250955,35252213-35252429 Length = 413 Score = 23.8 bits (49), Expect(2) = 7.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP+ P Sbjct: 29 PSPPPPPRLP 38 Score = 23.4 bits (48), Expect(2) = 7.6 Identities = 11/26 (42%), Positives = 11/26 (42%), Gaps = 4/26 (15%) Frame = +2 Query: 755 GXPPPXXGX----GGXXVXXPPPPPP 820 G PPP GG P PPPP Sbjct: 9 GLPPPAAAAAPAAGGERAPSPSPPPP 34 >02_01_0381 - 2764331-2764342,2768966-2769907 Length = 317 Score = 25.0 bits (52), Expect(2) = 7.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP P GGG Sbjct: 63 PPPPP--------PPPNQPSAGGG 78 Score = 22.2 bits (45), Expect(2) = 7.8 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 50 PPSSSAAEAASDLPPPPPP 68 >08_02_0937 + 22801526-22802461 Length = 311 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPP P+ PPP PP G Sbjct: 58 PNPPPEPEEEEEVSSPPPPPPPPPG 82 Score = 24.2 bits (50), Expect(2) = 7.8 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = +2 Query: 710 PFFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 P F + + + PP V PPPPPP Sbjct: 42 PLFCPRCRGEFLEEENPNPPPEPEEEEEVSSPPPPPP 78 Score = 23.0 bits (47), Expect(2) = 7.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 803 PPPPPPXF 826 PPPPPP F Sbjct: 76 PPPPPPGF 83 >07_01_0015 + 108338-109186 Length = 282 Score = 25.8 bits (54), Expect(2) = 7.9 Identities = 11/22 (50%), Positives = 11/22 (50%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP-PPXPP 973 P PPPPP P P P PP Sbjct: 108 PPPPPPPLLPAAAAAPDSPSPP 129 Score = 21.4 bits (43), Expect(2) = 7.9 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 102 ICAPPPPPP 110 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 26.2 bits (55), Expect(2) = 7.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP P LPP P Sbjct: 240 PPPPPPSLLPPVPLLPPLIP 259 Score = 21.0 bits (42), Expect(2) = 7.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 239 PPPPPP 244 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 25.4 bits (53), Expect(2) = 7.9 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPPPPP F P PPPPP P Sbjct: 67 PPPPPPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPPPSP 112 Score = 21.8 bits (44), Expect(2) = 7.9 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGG 985 P P F PPP P GG Sbjct: 127 PTGPDPVHNKFQPPPPSPPNGG 148 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 24.6 bits (51), Expect(2) = 8.1 Identities = 10/21 (47%), Positives = 11/21 (52%), Gaps = 3/21 (14%) Frame = +2 Query: 911 PXPPPP---PKXPXXXFLPPP 964 P PPPP P P + PPP Sbjct: 174 PPPPPPAIWPPQPSFYYYPPP 194 Score = 22.6 bits (46), Expect(2) = 8.1 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G G G PPPPPP Sbjct: 156 AGGCSISDGGACGASCKPPPPPPP 179 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 24.2 bits (50), Expect(2) = 8.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P Sbjct: 124 PPPPPPPPSPKDAAADPAKEP 144 Score = 22.6 bits (46), Expect(2) = 8.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 905 FXPXPPPPP 931 F P PPPPP Sbjct: 121 FGPPPPPPP 129 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 153 PPPPPPPPPP-----PPPRPP 168 >10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 Length = 190 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 13 PAPPPPPTPP-----PPPAPP 28 >10_08_0912 - 21520088-21520426,21520534-21520674,21521235-21521294, 21521394-21521493,21521591-21521904,21522253-21522621, 21522993-21523104,21523627-21523787 Length = 531 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G +GGGG G Sbjct: 9 GGGGGGAQEPRGQYGGGGKNG 29 >10_08_0234 - 16067579-16068157 Length = 192 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G +G GGG G Sbjct: 72 GGGGGGGNSQYGGYGAGGGSG 92 >10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 Length = 526 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP+ P PPP P Sbjct: 14 PPPPPQEPAPLSPPPPLP 31 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 987 PPPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGG G GGGGG G Sbjct: 21 PAGFLGGGGGGGGGGGGGGGGGGGGG 46 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 905 FXPXPPP-PPKXPXXXFLPPPXPPXXGGG 988 + P PP P P PPP PP GGG Sbjct: 720 YAPYPPGITPSPPEYAPEPPPGPPGGGGG 748 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 80 PSPPPPPPPP-----PPPPPP 95 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 12 PAPPPPPPPP-----PPPPPP 27 >08_01_0059 - 394001-394708 Length = 235 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP + P PPP P Sbjct: 2 PPPPPPRRAPPPPATPPPPP 21 >07_03_1350 - 25955624-25955842,25955877-25955922,25956456-25956751 Length = 186 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P G GGG + G GGGGG G Sbjct: 131 PGDGQGGGGARRRVGGDGGGGGSG 154 >06_03_1153 - 28047125-28047751 Length = 208 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFF 829 G PPP + PPPPPP F+ Sbjct: 7 GAPPPPAIFCPPPLSPPPPPPPIFY 31 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 28.7 bits (61), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P PPP Sbjct: 91 PPPPPPPPLPQHRLEPPP 108 >06_01_0178 + 1386981-1387505 Length = 174 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG G GRK G GG GG G Sbjct: 75 GGGGKGRKGGAGGHGGAGGGG 95 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G PPPPP Sbjct: 1933 PPPPPPPVEGKPKPPPHAPPPPP 1955 >04_04_1182 + 31531426-31531702,31533741-31533997,31534672-31534818, 31535974-31536111 Length = 272 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 766 PXXGGGGGXGXFXPPPPP 819 P GGGGG G PP PP Sbjct: 50 PGGGGGGGGGMGIPPRPP 67 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 44 GGGGGGGSGGGGGGGGGGGGG 64 >03_05_0252 - 22403504-22404676 Length = 390 Score = 28.7 bits (61), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGG G Sbjct: 5 GGGGGGRAGRVGGGGGGGAGG 25 >02_04_0028 + 19027510-19027983,19028087-19028278,19028369-19028545, 19029568-19029663,19030487-19030618,19030950-19031008, 19031234-19031321,19031433-19031693 Length = 492 Score = 28.7 bits (61), Expect = 8.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PP PP+ P LPP P GGG Sbjct: 98 PRPPLPPRPPRPP-LPPLREPGEGGG 122 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 28.7 bits (61), Expect = 8.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 111 PPPPPPPHLLHYYGHPPPPPP 131 >04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 Length = 676 Score = 23.4 bits (48), Expect(2) = 9.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPP 814 PPP G V PPPP Sbjct: 489 PPPPRGNPPSWVPLPPPP 506 Score = 23.4 bits (48), Expect(2) = 9.4 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP PPP P Sbjct: 501 PLPPPPGGNAPSWVPPPPQP 520 >11_06_0671 + 26099292-26099491,26099589-26099622,26104787-26104813, 26105557-26105642,26105735-26105783,26105969-26106018, 26106692-26107185,26107379-26107539,26107808-26108017, 26108100-26108292,26108367-26108444,26108555-26108649, 26109158-26109280 Length = 599 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPP 964 PPPPP P PPP Sbjct: 9 PPPPPHGPVVVVPPPP 24 Score = 21.0 bits (42), Expect(2) = 9.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 8 PPPPPP 13 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 25.4 bits (53), Expect(2) = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP LPPP P Sbjct: 70 PKSPPPPPHIQTTDLPPPKP 89 Score = 21.4 bits (43), Expect(2) = 9.5 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A PPP PPPPP Sbjct: 55 AAAAPPPPAPLTPPPPKSPPPPP 77 >02_03_0279 + 17250347-17252098 Length = 583 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P F P Sbjct: 125 PPPPPPPPPPPPLFAKP 141 Score = 21.0 bits (42), Expect(2) = 9.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 124 PPPPPP 129 >06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258, 4384339-4384512,4384956-4385204,4386831-4386986 Length = 525 Score = 24.2 bits (50), Expect(2) = 9.6 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P G + PPPPPP Sbjct: 26 GGPLSKRAKAGVQMPAPPPPPP 47 Score = 22.6 bits (46), Expect(2) = 9.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 40 PAPPPPPPPP 49 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 24.2 bits (50), Expect(2) = 9.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 GG PPPPPP Sbjct: 94 GGGPAQPPPPPPP 106 Score = 22.6 bits (46), Expect(2) = 9.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 100 PPPPPPPPQP 109 >03_01_0499 - 3766713-3767159,3767742-3767813,3768004-3768657 Length = 390 Score = 25.8 bits (54), Expect(2) = 9.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 917 PPPPPKXPXXXFLP 958 PPPPP P FLP Sbjct: 64 PPPPPPHPHNPFLP 77 Score = 21.0 bits (42), Expect(2) = 9.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 63 PPPPPP 68 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 24.6 bits (51), Expect(2) = 9.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P P PP Sbjct: 29 PPPPPPLPPAAAAVEPLPP 47 Score = 22.2 bits (45), Expect(2) = 9.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PPP V PPPPPP Sbjct: 15 AAAPPPPPV-----QVPVPPPPPP 33 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 25.8 bits (54), Expect(2) = 10.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P PP Sbjct: 38 PPPPPPPPPPSQPSAPP 54 Score = 21.0 bits (42), Expect(2) = 10.0 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 37 PPPPPP 42 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,662,964 Number of Sequences: 37544 Number of extensions: 882905 Number of successful extensions: 15906 Number of sequences better than 10.0: 181 Number of HSP's better than 10.0 without gapping: 2988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12199 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3304646468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -