BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H10 (1102 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 2e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.006 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 0.011 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 33 0.011 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 0.011 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.029 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.058 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.064 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.066 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.11 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.15 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.23 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.23 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.43 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.54 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.54 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 0.56 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 0.59 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.71 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.2 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.2 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.2 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.2 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 31 1.2 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.3 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.2 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.2 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.8 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.8 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 30 3.8 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 24 4.6 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 5.0 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 5.1 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 25 5.7 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 6.6 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 7.1 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.8 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 8.8 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 8.8 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.8 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.8 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 8.8 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.5 bits (73), Expect(2) = 2e-04 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 316 PPPPPPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect(2) = 0.005 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGG 329 Score = 31.9 bits (69), Expect = 0.94 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GG P PPPPP GG P P Sbjct: 311 GGAPPPPPPPPPPPPGDGGAPPP 333 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GG P PPPPP GG P P Sbjct: 311 GGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 30.7 bits (66), Expect = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G GG PPPPP Sbjct: 317 PPPPPPPPPGDGGAPP--PPPPP 337 Score = 30.3 bits (65), Expect = 2.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 911 PXPPPPPK---XPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP GG Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGG 329 Score = 29.9 bits (64), Expect(2) = 2e-04 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPP 323 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPP 310 Score = 29.5 bits (63), Expect = 5.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 302 PAPPPPPPPGGAPPPP 317 Score = 29.1 bits (62), Expect(2) = 0.44 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPP 324 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 315 PPPPPPPPPPPGDGGAPPPPP 335 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG PPPPPP Sbjct: 321 PPPPPGDGGAP---PPPPPP 337 Score = 26.2 bits (55), Expect(2) = 0.005 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP G PPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPP 310 Score = 22.6 bits (46), Expect(2) = 0.44 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPP 974 P PPPP PP PP Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPP 337 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.5 bits (73), Expect(2) = 0.006 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 474 PPPPPPPPPPPPPPFPPPPPP 494 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPP 484 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPP 485 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPP 486 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPP 487 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPP 490 Score = 25.4 bits (53), Expect(2) = 4.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXF 826 PPP PPPPPP F Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPF 488 Score = 24.6 bits (51), Expect(2) = 0.006 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +2 Query: 701 KXXPFFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 K P F + + G PP PPPPPP Sbjct: 443 KHDPRLFSQDEDGDTEGVGQAPPPPPPPPPPPPPPPPPPP 482 Score = 22.6 bits (46), Expect(2) = 4.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 487 PFPPPPPPTP 496 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 29.5 bits (63), Expect(2) = 0.95 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PPP G Sbjct: 8 PGPPPPPSAPSGPVKPPPSSKNRG 31 Score = 28.7 bits (61), Expect(2) = 0.011 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPP 376 Score = 28.7 bits (61), Expect(2) = 0.011 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP + P + PP PP Sbjct: 371 PPPPPPGRRPPSGKINPPPPP 391 Score = 21.0 bits (42), Expect(2) = 0.95 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 2 PPPPPP 7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.1 bits (72), Expect = 0.41 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPP 401 Score = 33.1 bits (72), Expect = 0.41 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP+ P PPP PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPP 407 Score = 33.1 bits (72), Expect(2) = 0.018 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPP 425 Score = 33.1 bits (72), Expect(2) = 0.011 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPP 426 Score = 32.7 bits (71), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPP 390 Score = 32.7 bits (71), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPP 400 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPP 385 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPP 386 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPP 387 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPP 396 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPP 413 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPP 415 Score = 32.3 bits (70), Expect(2) = 0.031 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPP 416 Score = 32.3 bits (70), Expect(2) = 0.031 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPP 417 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPP 418 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPP 421 Score = 32.3 bits (70), Expect(2) = 0.031 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPP 427 Score = 32.3 bits (70), Expect(2) = 0.031 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPP 428 Score = 32.3 bits (70), Expect(2) = 0.031 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 409 PPPPPPPPPPAPPPPPPPPPP 429 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 411 PPPPPPPPAPPPPPPPPPPPP 431 Score = 32.3 bits (70), Expect = 0.71 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 412 PPPPPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPP 402 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P P PPP PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPP 403 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PP PP P PPP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPP 404 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPP 406 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P P PPP PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPP 409 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PP PP P PPP PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPP 410 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P P PPP P PPP PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPP 411 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPP 412 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 410 PPPPPPPPPAPPPPPPPPPPP 430 Score = 24.2 bits (50), Expect(2) = 0.011 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPP 402 Score = 24.2 bits (50), Expect(2) = 7.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 408 PPPPPPPPPPPAPPPPPPPP 427 Score = 23.4 bits (48), Expect(2) = 0.031 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPP 403 Score = 23.4 bits (48), Expect(2) = 0.031 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPP 404 Score = 23.4 bits (48), Expect(2) = 0.031 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPP 408 Score = 23.4 bits (48), Expect(2) = 0.031 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPP 409 Score = 23.4 bits (48), Expect(2) = 0.018 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPP 410 Score = 23.4 bits (48), Expect(2) = 0.031 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPP 414 Score = 23.0 bits (47), Expect(2) = 7.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP Sbjct: 421 PPPPPPPPPPPPALRLACAPP 441 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect(2) = 0.011 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPP 288 Score = 28.7 bits (61), Expect(2) = 0.011 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP + P + PP PP Sbjct: 283 PPPPPPGRRPPSGKINPPPPP 303 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 33.9 bits (74), Expect(2) = 0.029 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPP 711 Score = 29.9 bits (64), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 683 PPPPPPPPPPPPP--PPPPPP 701 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQP 703 Score = 29.5 bits (63), Expect(2) = 0.87 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 690 PPPPPPPPPPPPQPSTPPPPP 710 Score = 27.5 bits (58), Expect(2) = 3.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP+ PP PP G Sbjct: 695 PPPPPPPQPSTPPPPPPSTPPVQQSG 720 Score = 21.8 bits (44), Expect(2) = 0.029 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 682 VPPPPPPPP 690 Score = 21.0 bits (42), Expect(2) = 3.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 686 PPPPPP 691 Score = 21.0 bits (42), Expect(2) = 0.87 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 689 PPPPPP 694 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.9 bits (79), Expect = 0.058 Identities = 26/85 (30%), Positives = 30/85 (35%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFX 910 ++K K PPP G + PPPPPP L Sbjct: 670 QEKLKKVPPPPPPLPVIEGSSLSVPPPPPPP--PPPLLSGTLPMPPPPPPPPPGCAGL-- 725 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPP P+ P LPPP PP G Sbjct: 726 PPPPPSPQ-PGCAGLPPPPPPPPPG 749 Score = 30.3 bits (65), Expect = 2.9 Identities = 23/87 (26%), Positives = 25/87 (28%) Frame = +3 Query: 729 KKKKXXXPGXPPPPXXGXGGXXSFXPPPPPXXFFXFXFYXXXXXXXXXXXXXXXXXXXXX 908 ++K P PPP G S PPPPP Sbjct: 670 QEKLKKVPPPPPPLPVIEGSSLSVPPPPPPPP----PPLLSGTLPMPPPPPPPPPGCAGL 725 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PP PQ PP PP G G Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAG 752 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G PPPPP Sbjct: 738 GLPPPPPPPPPGCAGLPPPPPP 759 Score = 26.2 bits (55), Expect(2) = 3.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP G P P Sbjct: 697 PPPPPPPLLSGTLPMP 712 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 Query: 812 GGGXKXPXPPPPP 774 G P PPPPP Sbjct: 688 GSSLSVPPPPPPP 700 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.1 bits (72), Expect(2) = 0.064 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPP 1179 Score = 32.7 bits (71), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPP 1178 Score = 32.7 bits (71), Expect = 0.54 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPP 1182 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP 1177 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPP 1181 Score = 21.4 bits (43), Expect(2) = 0.064 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 1156 IPPPPPPPP 1164 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.5 bits (73), Expect = 0.31 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP PP GG Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGG 686 Score = 33.1 bits (72), Expect = 0.41 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGG 686 Score = 31.9 bits (69), Expect = 0.94 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP GG PPPPP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPP 680 Score = 31.9 bits (69), Expect = 0.94 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GG P PPPPP GG P P Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPP 691 Score = 31.9 bits (69), Expect = 0.94 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP GG Sbjct: 677 PPPPPPLPGGA-APPPPPPIGGG 698 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGGG 988 PPPP P PP PP GGG Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGG 698 Score = 30.7 bits (66), Expect(2) = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP GG Sbjct: 689 PPPPP--PIGGGAPPPPPPGFGG 709 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G PPP GG G PPPPP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPP 682 Score = 29.5 bits (63), Expect = 5.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 Query: 788 PPPPPXXGGGXPXP 747 PPPPP GGG P P Sbjct: 689 PPPPPPIGGGAPPP 702 Score = 23.8 bits (49), Expect(2) = 0.066 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A G PPP PPPPP Sbjct: 672 AGGAPPPPPPPLPGGAAPPPPPP 694 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 27.1 bits (57), Expect(2) = 0.11 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 P G GG PPPPPP Sbjct: 784 PEGEGVGGITPPPPPPPPP 802 Score = 26.6 bits (56), Expect(2) = 0.11 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P +P P Sbjct: 796 PPPPPPPPPPEDLIIPLP 813 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.7 bits (71), Expect(2) = 0.15 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 215 PPPPPPPPSPSPPRPPPPPPP 235 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPP 222 Score = 29.5 bits (63), Expect = 5.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P P PPP PP Sbjct: 218 PPPPPSPSPPRPPPPPPPSPP 238 Score = 28.7 bits (61), Expect = 8.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 213 PSPPPPPPPPSPSPPRPPPPP 233 Score = 27.1 bits (57), Expect(2) = 0.54 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P PP Sbjct: 229 PPPPPPPSPPRPLAAKLPEPP 249 Score = 26.2 bits (55), Expect(2) = 0.91 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPP P P LP P P Sbjct: 231 PPPPPSPPRPLAAKLPEPPP 250 Score = 24.2 bits (50), Expect(2) = 0.91 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 215 PPPPPPPPSPSPPRPPPPPP 234 Score = 24.2 bits (50), Expect(2) = 0.54 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 216 PPPPPPPSPSPPRPPPPPPP 235 Score = 20.6 bits (41), Expect(2) = 0.15 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPP 222 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.9 bits (64), Expect(2) = 0.23 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 Score = 22.6 bits (46), Expect(2) = 0.23 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G V PPPPPP Sbjct: 76 GPAAVIPPPPPPP 88 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 33.9 bits (74), Expect = 0.23 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPP 931 G PPP G + PPPP P F P PPPPP Sbjct: 384 GGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 31.5 bits (68), Expect = 1.2 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP GG PPP PP + PPPPP Sbjct: 385 GPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYI--------------PPPPPG 430 Query: 935 XPXXXFLPPPXPP 973 P F PPP PP Sbjct: 431 FP--QFQPPPPPP 441 Score = 30.7 bits (66), Expect = 2.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 PG PPPP GG PPP P Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGP 405 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 33.5 bits (73), Expect = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 755 PPPPPPPAVPGEGARPPPPPP 775 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.9 bits (64), Expect(2) = 0.43 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP F PP PP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPP 25 Score = 21.8 bits (44), Expect(2) = 0.43 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 4 VPPPPPPPP 12 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 32.7 bits (71), Expect = 0.54 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 195 PPPPPPGPGG--IPPPPPPIRGG 215 Score = 29.1 bits (62), Expect = 6.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G GG PPPPP Sbjct: 195 PPPPPPGPGG---IPPPPPP 211 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.7 bits (71), Expect = 0.54 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 812 GGGXKXPXPPPPPXXGGGXPXP 747 GGG P PPPPP GGG P P Sbjct: 658 GGGMFPPPPPPPP--GGGVPGP 677 Score = 31.9 bits (69), Expect = 0.94 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 F PPPP P PPP PP GGG Sbjct: 649 FGGIPPPP---PGGGMFPPPPPPPPGGG 673 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PP PP G Sbjct: 663 PPPPPPPPGGGVPGPPKPPPPG 684 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.7 bits (61), Expect(2) = 0.56 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LPPP PP Sbjct: 425 PPPPPPAP----LPPPPPP 439 Score = 22.6 bits (46), Expect(2) = 0.56 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P V PPPPPP Sbjct: 411 PTPNRRRRRSLVQPPPPPPP 430 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect(2) = 0.59 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPP 964 PPPPP P LPPP Sbjct: 170 PPPPPSTPSSSLLPPP 185 Score = 21.8 bits (44), Expect(2) = 0.59 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP + PPPPPP Sbjct: 158 PPPS---SSPPLSSPPPPPP 174 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.3 bits (70), Expect = 0.71 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPP 928 A G PPP PPPPP + P PPPP Sbjct: 147 ATGGPPPPPPIA--PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Query: 929 PKXPXXXFLPPPXPP 973 P P L P PP Sbjct: 205 PPPPPILELAAPPPP 219 Score = 31.9 bits (69), Expect = 0.94 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP--PXXGG 985 P PPPPP P PPP P P GG Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGG 150 Score = 26.6 bits (56), Expect(2) = 2.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP PPP PP Sbjct: 138 PPPPPPIAPATGGPPPPPP 156 Score = 22.2 bits (45), Expect(2) = 2.8 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PPP PPPPPP Sbjct: 123 APSPPPPPTSPA---TRAPPPPPP 143 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP PPP PP G Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFG 219 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 198 PPPPPPPGFPGGAPPP 213 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +3 Query: 804 PPPPPXXFFXFXFYXXXXXXXXXXXXXXXXXXXXXPXXPPPPQXXRGXFFSXPPXPP 974 PPPPP F + PPPP RG + PP PP Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPP 82 Score = 30.3 bits (65), Expect = 2.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP+ +PPP PP G Sbjct: 50 PPPPPPPRFYDND-IPPPPPPRRG 72 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G + PPPPP Sbjct: 64 PPPPPPRRGFYDDYPPPPPP 83 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP+ PPP PP Sbjct: 65 PPPPPRRGFYDDYPPPPPP 83 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P G GGGR+ G GGGGG G Sbjct: 148 PVCGRGGGGRRGGGGCCGGGGGGG 171 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P G GGGR+ G GGGGG G Sbjct: 65 PVCGRGGGGRRGGGGCCGGGGGGG 88 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P G GGGR+ G GGGGG G Sbjct: 148 PVCGRGGGGRRGGGGCCGGGGGGG 171 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 27.9 bits (59), Expect(2) = 1.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPP+ P P PP GG Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAPGG 131 Score = 22.2 bits (45), Expect(2) = 1.3 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 734 KKXKXAXGXPPPXXGXGGXXVXXPPPPP 817 KK G PPP + PPPP Sbjct: 86 KKTCGTCGDPPPPATPPPPTMPPTPPPP 113 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.7 bits (66), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G Sbjct: 867 PPPPPPPPPPPPP--PPPPPPASSTG 890 Score = 28.7 bits (61), Expect = 8.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPP 884 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.7 bits (66), Expect = 2.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PP PP P + PPP PP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPP 115 Score = 30.7 bits (66), Expect = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPP-PKXPXXXFLPPPXPP 973 P PPPP P P + PPP PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPP 168 Score = 30.7 bits (66), Expect = 2.2 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPP-PKXPXXXFLPPPXPP 973 P PPPP P P + PPP PP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPP 194 Score = 29.1 bits (62), Expect = 6.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPP P P + PPP PP Sbjct: 163 PPPNPPPPNAPYPPPPYPP 181 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPP P + PPP P Sbjct: 220 PPYPPPPNAPNPPYPPPPNP 239 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 27.1 bits (57), Expect(2) = 3.5 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 911 PXPPPPPKXPXXXF---LPPPXPP 973 P PPPPP+ LPPP PP Sbjct: 211 PPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 21.4 bits (43), Expect(2) = 3.5 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP + PPPPPP Sbjct: 200 PPPLDDLDD--LPPPPPPPP 217 >SB_47581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 763 PPXXGGGGGXGXFXPPPPP 819 P GGGGG F P PPP Sbjct: 6 PQVGGGGGGSASFPPSPPP 24 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 102 PPPPPPPPPPPPP--PPPPPP 120 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.9 bits (64), Expect = 3.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -3 Query: 806 GXKXPXPPPPPXXGGGXPXP 747 G P PPPPP GG P P Sbjct: 359 GGAAPPPPPPPPVGGPPPPP 378 Score = 29.5 bits (63), Expect = 5.0 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 6/82 (7%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXP------PPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPX 916 G PPP G P PPPPP Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAA 362 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 363 PPPPPPPPVGG-PPPPPPPIEG 383 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXPXP 747 GG P PPPPP G P P Sbjct: 359 GGAAPPPPPPPPVGGPPPPPP 379 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 24.2 bits (50), Expect(2) = 4.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 297 PPPAPPLPNFTSPSPPPPPP 316 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 13/46 (28%), Positives = 14/46 (30%) Frame = +2 Query: 794 VXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPP 931 V PPPPPP F + P PPPP Sbjct: 332 VLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 54 PPPPPPPPPPPP---PPPPPP 71 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 303 PPPPPLPAGVPAPPPPPPPPMLGG 326 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 5.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1311 PPPPPPPPPPPP---PPPLPP 1328 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 24.2 bits (50), Expect(2) = 5.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 767 PXXGXGGXXVXXPPPPPP 820 P G V PPPPPP Sbjct: 2311 PSTGSHSPSVPPPPPPPP 2328 Score = 23.4 bits (48), Expect(2) = 5.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP+ P Sbjct: 2322 PPPPPPPEQP 2331 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 25.4 bits (53), Expect(2) = 5.7 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 788 PPPPPXXGGGXPXP 747 PP PP GGG P P Sbjct: 460 PPLPPKRGGGPPLP 473 Score = 22.2 bits (45), Expect(2) = 5.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 Query: 800 KXPXPPPPP 774 K P PPPPP Sbjct: 437 KKPLPPPPP 445 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 29.1 bits (62), Expect = 6.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGG 916 P G GGGR+ G GGGGG Sbjct: 149 PMRGRGGGGRRGGRGRGGGGGG 170 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 6.6 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 4/27 (14%) Frame = +1 Query: 748 GXGXPPPXXGGGG----GXGXFXPPPP 816 G G PPP G GG G G PPPP Sbjct: 566 GGGPPPPGAGQGGPPPPGAGQEGPPPP 592 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 23.8 bits (49), Expect(2) = 7.1 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPP 974 PPPP G PP PP Sbjct: 928 PPPPPELLGSDADLPPPPP 946 Score = 23.4 bits (48), Expect(2) = 7.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 PG PP G F PPPPP Sbjct: 875 PGSPPT------GADDFPPPPPP 891 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 461 PIPPPPPMSP-----PPPTPP 476 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.7 bits (61), Expect = 8.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P LPPP PP G Sbjct: 68 PPPPPPPPPP----LPPP-PPSGG 86 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.7 bits (61), Expect = 8.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P LPPP PP G Sbjct: 292 PPPPPPPPPP----LPPP-PPSGG 310 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGG 47 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.7 bits (61), Expect = 8.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG G GGGGG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMG 1781 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.7 bits (61), Expect = 8.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P PPP PP Sbjct: 198 PPPPAPPGALIPPPPAPP 215 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,567,952 Number of Sequences: 59808 Number of extensions: 435501 Number of successful extensions: 4542 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3098 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3355642219 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -