BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H10 (1102 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 43 0.002 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 32 0.021 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 32 0.021 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 32 0.021 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 36 0.035 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 36 0.036 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 36 0.037 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 36 0.060 AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein. 36 0.060 M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 36 0.060 M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 36 0.060 BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc... 36 0.060 AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans... 36 0.060 AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc... 36 0.060 AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc... 36 0.060 AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans... 36 0.060 BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc... 36 0.060 BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc... 36 0.060 BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein. 36 0.060 AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans... 36 0.060 AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc... 36 0.060 AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc... 36 0.060 AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans... 36 0.060 BX511262-10|CAM45801.1| 743|Homo sapiens HLA-B associated trans... 36 0.062 AL805934-12|CAI18508.2| 743|Homo sapiens HLA-B associated trans... 36 0.062 AL670886-3|CAM25014.1| 743|Homo sapiens HLA-B associated transc... 36 0.062 AL662847-3|CAO72072.1| 743|Homo sapiens HLA-B associated transc... 36 0.062 AL662801-55|CAI18316.2| 743|Homo sapiens HLA-B associated trans... 36 0.062 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 33 0.079 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 33 0.079 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 33 0.079 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 32 0.080 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 32 0.080 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 33 0.081 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 32 0.10 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 36 0.20 DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. 36 0.20 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 36 0.20 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 36 0.20 AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. 36 0.20 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 36 0.20 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 32 0.24 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 32 0.24 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 32 0.24 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 32 0.24 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 32 0.24 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 32 0.24 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 31 0.24 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 32 0.24 BC064990-1|AAH64990.1| 1147|Homo sapiens splicing factor, argini... 36 0.26 BC052286-1|AAH52286.1| 1147|Homo sapiens splicing factor, argini... 36 0.26 BC043353-1|AAH43353.1| 1146|Homo sapiens splicing factor, argini... 36 0.26 BC014921-1|AAH14921.1| 1147|Homo sapiens splicing factor, argini... 36 0.26 AL117417-1|CAB55911.1| 667|Homo sapiens hypothetical protein pr... 36 0.26 AF023142-1|AAD09327.1| 1157|Homo sapiens pre-mRNA splicing SR pr... 36 0.26 AB032998-1|BAA86486.1| 929|Homo sapiens KIAA1172 protein protein. 36 0.26 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 31 0.27 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 32 0.29 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 32 0.29 D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B ... 33 0.30 BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland andr... 33 0.30 AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich p... 33 0.30 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 34 0.31 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 34 0.31 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 34 0.33 EF119711-1|ABO69251.1| 3327|Homo sapiens beta-xin protein. 36 0.35 D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. 36 0.35 AY820969-1|AAV87913.1| 3345|Homo sapiens CMYA3 protein. 36 0.35 AL832331-1|CAD38624.1| 1946|Homo sapiens hypothetical protein pr... 36 0.35 AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor ... 31 0.35 AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. 31 0.35 AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcri... 31 0.36 AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. 31 0.37 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 28 0.40 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 30 0.49 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 31 0.50 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 31 0.50 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho... 31 0.50 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 31 0.50 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 31 0.50 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 31 0.50 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 31 0.50 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 0.51 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 0.51 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 31 0.51 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 29 0.51 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 29 0.51 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 29 0.51 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 29 0.51 AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens ... 31 0.51 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 31 0.51 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 35 0.61 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 35 0.61 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 35 0.61 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 35 0.61 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 35 0.61 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 35 0.61 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 35 0.61 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 29 0.70 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 29 0.70 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 29 0.70 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 29 0.70 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 34 0.80 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 34 0.80 BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. 34 0.80 BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. 34 0.80 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 34 0.80 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 34 0.80 AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP lik... 34 0.80 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 34 0.80 AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. 34 0.80 AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. 34 0.80 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 34 0.80 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 34 1.1 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 34 1.1 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 34 1.1 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 34 1.1 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 34 1.1 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 34 1.1 AL833083-1|CAD89973.1| 1067|Homo sapiens hypothetical protein pr... 34 1.1 AL590999-1|CAI16176.2| 1068|Homo sapiens dishevelled associated ... 34 1.1 AL357412-1|CAI23288.2| 1068|Homo sapiens dishevelled associated ... 34 1.1 AL136089-1|CAI20010.2| 1068|Homo sapiens dishevelled associated ... 34 1.1 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 34 1.1 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 34 1.1 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 34 1.1 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 34 1.1 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 34 1.1 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 34 1.1 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 34 1.1 AB002379-1|BAA20835.2| 1114|Homo sapiens KIAA0381 protein protein. 34 1.1 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 33 1.4 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 33 1.4 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 33 1.4 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 33 1.4 AF112209-1|AAF17197.1| 416|Homo sapiens Ena-VASP-like protein p... 31 1.5 EF078888-1|ABK41959.1| 355|Homo sapiens Kruppel-like factor 2 (... 28 1.5 BC071983-1|AAH71983.1| 355|Homo sapiens Kruppel-like factor 2 (... 28 1.5 AF205849-1|AAF13295.1| 355|Homo sapiens Kruppel-like factor pro... 28 1.5 AF134053-1|AAD55891.1| 355|Homo sapiens Kruppel-like factor LKL... 28 1.5 AF123344-1|AAD25076.1| 355|Homo sapiens Kruppel-like zinc finge... 28 1.5 BC063682-1|AAH63682.1| 264|Homo sapiens FAM39DP protein protein. 30 1.6 AY341937-1|AAQ76876.1| 264|Homo sapiens CXYorf1 protein. 30 1.6 AY341936-1|AAQ76875.1| 264|Homo sapiens CXYorf1 protein. 30 1.6 BC035342-1|AAH35342.1| 224|Homo sapiens Similar to Kruppel-like... 28 1.6 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 33 1.8 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 33 1.8 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 26 1.9 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 26 1.9 BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. 27 1.9 BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. 27 1.9 U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated pr... 27 1.9 BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein pr... 27 1.9 U87166-1|AAC39757.1| 508|Homo sapiens spectrin SH3 domain bindi... 31 2.0 AF540955-1|AAN28379.1| 476|Homo sapiens Abl-interactor 1 protein. 31 2.0 BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IM... 27 2.1 BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subuni... 27 2.1 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 32 2.4 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 32 2.4 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 33 2.4 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 33 2.4 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 33 2.4 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 29 2.5 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 29 2.5 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 29 2.5 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 29 2.5 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 29 2.5 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 29 2.5 AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 29 3.1 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 32 3.2 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 32 3.2 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 32 3.2 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 32 3.2 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 32 3.2 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 32 3.2 AL157405-2|CAI19766.1| 73|Homo sapiens small proline-rich prot... 32 3.2 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 32 3.2 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 32 3.2 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 32 3.2 AF333957-1|AAK70944.1| 73|Homo sapiens small proline-rich prot... 32 3.2 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 32 3.2 AB048287-1|BAB40642.1| 73|Homo sapiens small proline rich prot... 32 3.2 AL390961-5|CAI17276.1| 481|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-5|CAH73113.1| 481|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL390961-1|CAI17277.1| 480|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-1|CAH73114.1| 480|Homo sapiens spectrin SH3 domain bin... 30 3.3 AF006516-1|AAB62569.1| 480|Homo sapiens e3B1 protein. 30 3.3 BC024254-1|AAH24254.1| 476|Homo sapiens abl-interactor 1 protein. 30 3.3 AL390961-4|CAI17274.1| 476|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL390961-2|CAI17273.1| 475|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-4|CAH73115.1| 476|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-2|CAH73119.1| 475|Homo sapiens spectrin SH3 domain bin... 30 3.3 AB209268-1|BAD92505.1| 476|Homo sapiens Abl-interactor 1 varian... 30 3.3 AL390961-8|CAI17279.1| 451|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL390961-6|CAI17278.1| 452|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-8|CAH73117.1| 451|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-6|CAH73116.1| 452|Homo sapiens spectrin SH3 domain bin... 30 3.3 AF001628-1|AAD00897.1| 451|Homo sapiens interactor protein AblB... 30 3.3 AB040151-1|BAB55675.1| 452|Homo sapiens hNap1 Binding Protein p... 30 3.3 AL390961-3|CAI17272.1| 446|Homo sapiens spectrin SH3 domain bin... 30 3.3 AL139404-3|CAH73118.1| 446|Homo sapiens spectrin SH3 domain bin... 30 3.3 AF260262-1|AAF70309.1| 446|Homo sapiens Abl-interactor protein ... 30 3.3 AB067470-1|BAB67776.1| 1480|Homo sapiens KIAA1883 protein protein. 26 4.0 AB084087-1|BAC67014.1| 1422|Homo sapiens Formactin2 protein. 31 4.0 AB051482-1|BAB21786.1| 1199|Homo sapiens KIAA1695 protein protein. 31 4.0 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 32 4.3 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 32 4.3 BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. 29 4.4 AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens ... 29 4.4 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 29 4.5 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 29 4.5 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 29 4.5 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 29 4.5 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 29 4.5 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 29 4.5 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 29 4.5 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 29 4.5 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 29 4.5 AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens ... 29 4.6 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 29 4.9 AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318... 29 5.0 AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318... 29 5.0 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 28 5.0 AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator pro... 29 5.0 AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. 29 5.0 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 29 5.5 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 29 5.5 AF492646-1|AAO85488.1| 546|Homo sapiens proline rich, vinculin ... 27 5.5 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 31 5.6 BC070071-1|AAH70071.1| 1271|Homo sapiens RBM16 protein protein. 31 5.6 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 31 5.6 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 31 5.6 AL833928-1|CAD38784.1| 614|Homo sapiens hypothetical protein pr... 31 5.6 AL591499-2|CAH70694.1| 1271|Homo sapiens RNA binding motif prote... 31 5.6 AL136976-1|CAI21482.1| 1271|Homo sapiens RNA binding motif prote... 31 5.6 AL121952-2|CAI21474.1| 1271|Homo sapiens RNA binding motif prote... 31 5.6 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 31 5.6 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 31 5.6 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 31 5.6 AB029039-1|BAA83068.2| 1330|Homo sapiens KIAA1116 protein protein. 31 5.6 AB023209-1|BAA76836.1| 772|Homo sapiens KIAA0992 protein protein. 26 7.0 AK000342-1|BAA91097.1| 649|Homo sapiens protein ( Homo sapiens ... 25 7.1 AL590105-9|CAI13020.2| 590|Homo sapiens PWWP domain containing ... 25 7.1 DQ124707-1|AAZ38821.1| 578|Homo sapiens modulator of Na,K-ATPas... 25 7.1 AY274811-1|AAP42076.1| 578|Homo sapiens PX serine/threonine kin... 25 7.1 AY437879-1|AAR98521.1| 545|Homo sapiens PX ser/thr kinase v2 pr... 25 7.2 BC068574-1|AAH68574.1| 513|Homo sapiens PWWP domain containing ... 25 7.2 AB209047-1|BAD92284.1| 507|Homo sapiens ELK1, member of ETS onc... 28 7.2 AY847220-1|AAX73352.1| 495|Homo sapiens PX serine/threonine kin... 25 7.2 AY847221-1|AAX73353.1| 441|Homo sapiens PX serine/threonine kin... 25 7.3 AY847222-1|AAX73354.1| 352|Homo sapiens PX serine/threonine kin... 25 7.4 U94832-1|AAB53222.1| 711|Homo sapiens KSRP protein. 31 7.5 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 31 7.5 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 31 7.5 BC094707-1|AAH94707.1| 106|Homo sapiens SMR3B protein protein. 31 7.5 BC085004-1|AAH85004.1| 710|Homo sapiens KHSRP protein protein. 31 7.5 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 31 7.5 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 31 7.5 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 31 7.5 AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrom... 31 7.5 AF093747-1|AAD29861.1| 115|Homo sapiens KH type splicing regula... 31 7.5 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 31 7.5 U80017-3|AAC52048.1| 294|Homo sapiens survival motor neuron pro... 25 7.6 U43883-1|AAC50473.1| 294|Homo sapiens survival motor neuron pro... 25 7.6 U21914-1|AAA64505.1| 293|Homo sapiens U18423; it is not known i... 25 7.6 U18423-1|AAA66242.1| 294|Homo sapiens spinal muscular atrophy d... 25 7.6 BC062723-1|AAH62723.1| 294|Homo sapiens survival of motor neuro... 25 7.6 BC015308-1|AAH15308.1| 294|Homo sapiens survival of motor neuro... 25 7.6 AC005031-2|AAC62262.1| 294|Homo sapiens survival of motor neuro... 25 7.6 AC004999-1|AAC83178.1| 294|Homo sapiens survival motor neuron 1... 25 7.6 BC070242-1|AAH70242.1| 282|Homo sapiens survival of motor neuro... 25 7.6 BC000908-1|AAH00908.1| 282|Homo sapiens SMN1 protein protein. 25 7.6 AK128663-1|BAC87557.1| 279|Homo sapiens protein ( Homo sapiens ... 25 7.6 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 29 7.7 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 29 7.7 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 29 7.7 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 29 7.7 AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. 28 8.5 AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. 28 8.5 AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mix... 28 8.5 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 28 8.6 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 28 8.6 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 28 8.6 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 26 8.7 U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid... 31 9.9 U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. 31 9.9 BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid ... 31 9.9 BC016169-1|AAH16169.1| 333|Homo sapiens GIPC PDZ domain contain... 31 9.9 BC012810-1|AAH12810.1| 333|Homo sapiens GIPC PDZ domain contain... 31 9.9 BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. 31 9.9 BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. 31 9.9 BC000410-1|AAH00410.1| 333|Homo sapiens GIPC PDZ domain contain... 31 9.9 AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HM... 31 9.9 AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens ... 31 9.9 AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. 31 9.9 AF089816-1|AAC67548.1| 333|Homo sapiens RGS-GAIP interacting pr... 31 9.9 AB209210-1|BAD92447.1| 387|Homo sapiens dishevelled 1 isoform a... 31 9.9 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 42.7 bits (96), Expect = 0.002 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = +2 Query: 761 PPPXXGXG-GXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKX 937 PPP G G G PPPPPP P PPPPP Sbjct: 32 PPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPPPPPPS 91 Query: 938 PXXXFLPPPXPP 973 P + PPP PP Sbjct: 92 PGASY-PPPQPP 102 Score = 34.7 bits (76), Expect = 0.61 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PP GG PP P P P PPPPP Sbjct: 17 GLPPLPGPKGGFEPGPPPAPGPGAGLLAPGPPPPPPVGSMGALTAAFPFAALPPPPPPPP 76 Query: 935 XPXXXFLPPPXPPXXGG 985 P PPP PP G Sbjct: 77 PPPPQQPPPPPPPPSPG 93 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 31.9 bits (69), Expect(2) = 0.021 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 589 PPPPPPPGTDGPVPPPPPPPPPPPGG 614 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 587 PPPPPPPPPGTDGPVPPPPPPPP 609 Score = 30.3 bits (65), Expect(2) = 0.65 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 587 PPPPPPPPPGTDGPVPPPPPP 607 Score = 26.6 bits (56), Expect(2) = 0.021 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 574 PPPAPPLPGDLPPPPPPPPP 593 Score = 26.6 bits (56), Expect(2) = 1.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 589 PPPPPPPGTDGPVPPPPPPP 608 Score = 25.4 bits (53), Expect(2) = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 600 PVPPPPPPPPP----PPGGPP 616 Score = 23.0 bits (47), Expect(2) = 0.65 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 575 PPAPPLPGDLPPPPPPPPPP 594 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 31.9 bits (69), Expect(2) = 0.021 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 480 PPPPPPPGTDGPVPPPPPPPPPPPGG 505 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 478 PPPPPPPPPGTDGPVPPPPPPPP 500 Score = 30.3 bits (65), Expect(2) = 0.65 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 478 PPPPPPPPPGTDGPVPPPPPP 498 Score = 26.6 bits (56), Expect(2) = 0.021 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 465 PPPAPPLPGDLPPPPPPPPP 484 Score = 26.6 bits (56), Expect(2) = 1.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 480 PPPPPPPGTDGPVPPPPPPP 499 Score = 25.4 bits (53), Expect(2) = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 491 PVPPPPPPPPP----PPGGPP 507 Score = 23.0 bits (47), Expect(2) = 0.65 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 466 PPAPPLPGDLPPPPPPPPPP 485 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 31.9 bits (69), Expect(2) = 0.021 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 171 PPPPPPPGTDGPVPPPPPPPPPPPGG 196 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 169 PPPPPPPPPGTDGPVPPPPPPPP 191 Score = 30.3 bits (65), Expect(2) = 0.67 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 169 PPPPPPPPPGTDGPVPPPPPP 189 Score = 26.6 bits (56), Expect(2) = 0.021 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 156 PPPAPPLPGDLPPPPPPPPP 175 Score = 26.6 bits (56), Expect(2) = 1.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 171 PPPPPPPGTDGPVPPPPPPP 190 Score = 25.4 bits (53), Expect(2) = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 182 PVPPPPPPPPP----PPGGPP 198 Score = 23.0 bits (47), Expect(2) = 0.67 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 157 PPAPPLPGDLPPPPPPPPPP 176 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 35.9 bits (79), Expect(2) = 0.035 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 1421 PPPPPPPPPPPPLALPPPPPP 1441 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1422 PPPPPPPPPPPLALPPPPPPP 1442 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1423 PPPPPPPPPPLALPPPPPPPP 1443 Score = 26.2 bits (55), Expect(2) = 3.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P LPPP P Sbjct: 1436 PPPPPPPPP---LPPPLP 1450 Score = 24.6 bits (51), Expect(2) = 3.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP + PPPPPP Sbjct: 1422 PPPPPPPPPPPLALPPPPPP 1441 Score = 21.8 bits (44), Expect(2) = 0.035 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 1419 VHPPPPPPP 1427 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 35.9 bits (79), Expect(2) = 0.036 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 655 PPPPPPPPPPPPLALPPPPPP 675 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 656 PPPPPPPPPPPLALPPPPPPP 676 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 657 PPPPPPPPPPLALPPPPPPPP 677 Score = 26.2 bits (55), Expect(2) = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P LPPP P Sbjct: 670 PPPPPPPPP---LPPPLP 684 Score = 24.6 bits (51), Expect(2) = 3.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP + PPPPPP Sbjct: 656 PPPPPPPPPPPLALPPPPPP 675 Score = 21.8 bits (44), Expect(2) = 0.036 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 653 VHPPPPPPP 661 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 35.9 bits (79), Expect(2) = 0.037 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 337 PPPPPPPPPPPPLALPPPPPP 357 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 338 PPPPPPPPPPPLALPPPPPPP 358 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 339 PPPPPPPPPPLALPPPPPPPP 359 Score = 26.2 bits (55), Expect(2) = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P LPPP P Sbjct: 352 PPPPPPPPP---LPPPLP 366 Score = 24.6 bits (51), Expect(2) = 3.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP + PPPPPP Sbjct: 338 PPPPPPPPPPPLALPPPPPP 357 Score = 21.8 bits (44), Expect(2) = 0.037 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 335 VHPPPPPPP 343 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 680 PPPPPPLPGEAGMPPPPPPLPGG 702 Score = 35.9 bits (79), Expect = 0.26 Identities = 23/82 (28%), Positives = 26/82 (31%), Gaps = 8/82 (9%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPP--------PPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPX 916 PPP GG + PPP PPP + Sbjct: 607 PPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARI 666 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPG 688 Score = 32.3 bits (70), Expect(2) = 0.13 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 693 PPPPPPLPGGPGIPPP-PPFPGG 714 Score = 29.5 bits (63), Expect(2) = 0.060 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + PP PP G Sbjct: 604 PPPPPPPPLPGGTAISPP-PPLSG 626 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP PP GG Sbjct: 599 PPPPPPP--------PPPPPPLPGG 615 Score = 27.5 bits (58), Expect(2) = 0.060 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 589 PPPAPGDSTTPPPPPPPPPP 608 Score = 25.8 bits (54), Expect(2) = 0.38 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPP 606 Score = 25.4 bits (53), Expect(2) = 5.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 599 PPPPPP-------PPPPPPPLPGG 615 Score = 24.6 bits (51), Expect(2) = 5.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPPP 607 Score = 23.4 bits (48), Expect(2) = 0.13 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G G + PPPP P Sbjct: 683 PPPLPGEAG--MPPPPPPLP 700 >AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein. Length = 1229 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 758 PPPPPPPPAPEQQTMPPPGSPSGGAG 783 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 754 PPPPPP 759 >M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-associated transcript 3 (BAT3) gene, 3' end. ). Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-associated transcript 3 (BAT3) mRNA, complete cds. ). Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated transcript 3 protein. Length = 1132 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 661 PPPPPPPPAPEQQTMPPPGSPSGGAG 686 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 657 PPPPPP 662 >BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated transcript 3 protein. Length = 1126 Score = 35.9 bits (79), Expect(2) = 0.060 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 655 PPPPPPPPAPEQQTMPPPGSPSGGAG 680 Score = 21.0 bits (42), Expect(2) = 0.060 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 651 PPPPPP 656 >BX511262-10|CAM45801.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 35.9 bits (79), Expect(2) = 0.062 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 691 PPPPPPPPAPEQQTMPPPGSPSGGAG 716 Score = 21.0 bits (42), Expect(2) = 0.062 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 687 PPPPPP 692 >AL805934-12|CAI18508.2| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 35.9 bits (79), Expect(2) = 0.062 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 691 PPPPPPPPAPEQQTMPPPGSPSGGAG 716 Score = 21.0 bits (42), Expect(2) = 0.062 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 687 PPPPPP 692 >AL670886-3|CAM25014.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 35.9 bits (79), Expect(2) = 0.062 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 691 PPPPPPPPAPEQQTMPPPGSPSGGAG 716 Score = 21.0 bits (42), Expect(2) = 0.062 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 687 PPPPPP 692 >AL662847-3|CAO72072.1| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 35.9 bits (79), Expect(2) = 0.062 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 691 PPPPPPPPAPEQQTMPPPGSPSGGAG 716 Score = 21.0 bits (42), Expect(2) = 0.062 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 687 PPPPPP 692 >AL662801-55|CAI18316.2| 743|Homo sapiens HLA-B associated transcript 3 protein. Length = 743 Score = 35.9 bits (79), Expect(2) = 0.062 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P +PPP P G G Sbjct: 691 PPPPPPPPAPEQQTMPPPGSPSGGAG 716 Score = 21.0 bits (42), Expect(2) = 0.062 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 687 PPPPPP 692 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 33.5 bits (73), Expect(2) = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P LPPP PP GG Sbjct: 558 PPPPPPLPGG-MLPPPPPPLPPGG 580 Score = 31.5 bits (68), Expect(2) = 0.079 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 570 PPPPPPLPPGGPPPPPGPPPLG 591 Score = 26.6 bits (56), Expect(2) = 4.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 582 PPPPGPPPLGAIMPPPGAP 600 Score = 25.0 bits (52), Expect(2) = 0.079 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPP PP Sbjct: 559 PPPPPLPGGMLPPPPPPLPP 578 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPP P Sbjct: 558 PPPPPPLPGGMLPPPPPPLP 577 Score = 21.8 bits (44), Expect(2) = 0.17 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G P P G PPPP P Sbjct: 542 APGGPFPSSVPGSLLPPPPPPPLP 565 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 33.5 bits (73), Expect(2) = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P LPPP PP GG Sbjct: 551 PPPPPPLPGG-MLPPPPPPLPPGG 573 Score = 31.5 bits (68), Expect(2) = 0.079 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 563 PPPPPPLPPGGPPPPPGPPPLG 584 Score = 26.6 bits (56), Expect(2) = 4.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 575 PPPPGPPPLGAIMPPPGAP 593 Score = 25.0 bits (52), Expect(2) = 0.079 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPP PP Sbjct: 552 PPPPPLPGGMLPPPPPPLPP 571 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPP P Sbjct: 551 PPPPPPLPGGMLPPPPPPLP 570 Score = 21.8 bits (44), Expect(2) = 0.17 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G P P G PPPP P Sbjct: 535 APGGPFPSSVPGSLLPPPPPPPLP 558 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 33.5 bits (73), Expect(2) = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P LPPP PP GG Sbjct: 551 PPPPPPLPGG-MLPPPPPPLPPGG 573 Score = 31.5 bits (68), Expect(2) = 0.079 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 563 PPPPPPLPPGGPPPPPGPPPLG 584 Score = 26.6 bits (56), Expect(2) = 4.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 575 PPPPGPPPLGAIMPPPGAP 593 Score = 25.0 bits (52), Expect(2) = 0.079 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPP PP Sbjct: 552 PPPPPLPGGMLPPPPPPLPP 571 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPP P Sbjct: 551 PPPPPPLPGGMLPPPPPPLP 570 Score = 21.8 bits (44), Expect(2) = 0.17 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G P P G PPPP P Sbjct: 535 APGGPFPSSVPGSLLPPPPPPPLP 558 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 581 PGPPPPPPLPSTGPPPPPPPP 601 Score = 32.3 bits (70), Expect(2) = 0.080 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 595 PPPPPPPPLPNQVPPPPPPPP 615 Score = 30.3 bits (65), Expect(2) = 0.86 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 594 PPPPPPP-PPLPNQVPPPPPP 613 Score = 24.2 bits (50), Expect(2) = 0.080 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 583 PPPPPPLPSTGPPPPPPPPP 602 Score = 22.6 bits (46), Expect(2) = 0.86 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 582 GPPPPPPLPSTGPPPPPPPPP 602 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 581 PGPPPPPPLPSTGPPPPPPPP 601 Score = 32.3 bits (70), Expect(2) = 0.080 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 595 PPPPPPPPLPNQVPPPPPPPP 615 Score = 30.3 bits (65), Expect(2) = 0.86 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 594 PPPPPPP-PPLPNQVPPPPPP 613 Score = 24.2 bits (50), Expect(2) = 0.080 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 583 PPPPPPLPSTGPPPPPPPPP 602 Score = 22.6 bits (46), Expect(2) = 0.86 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 582 GPPPPPPLPSTGPPPPPPPPP 602 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 33.5 bits (73), Expect(2) = 0.18 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P LPPP PP GG Sbjct: 145 PPPPPPLPGG-MLPPPPPPLPPGG 167 Score = 31.5 bits (68), Expect(2) = 0.081 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P PPP PP G Sbjct: 157 PPPPPPLPPGGPPPPPGPPPLG 178 Score = 26.6 bits (56), Expect(2) = 4.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 169 PPPPGPPPLGAIMPPPGAP 187 Score = 25.0 bits (52), Expect(2) = 0.081 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPP PP Sbjct: 146 PPPPPLPGGMLPPPPPPLPP 165 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G + PPPP P Sbjct: 145 PPPPPPLPGGMLPPPPPPLP 164 Score = 21.8 bits (44), Expect(2) = 0.18 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G P P G PPPP P Sbjct: 129 APGGPFPSSVPGSLLPPPPPPPLP 152 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 32.3 bits (70), Expect(2) = 0.10 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP-PXXGGG 988 P PPPPP+ P PPP P P G G Sbjct: 22 PPPPPPPRPPKQQPPPPPPPAPPPGPG 48 Score = 26.6 bits (56), Expect(2) = 5.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PP PP Sbjct: 36 PPPPPPAPPPGPGPAPPQHPP 56 Score = 23.8 bits (49), Expect(2) = 0.10 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P G PPPPPP Sbjct: 6 GGGRPGESPGASPTTGPPPPPP 27 Score = 23.4 bits (48), Expect(2) = 5.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 22 PPPPPPPRPPKQQPPPPPPP 41 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGG 713 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 678 PPPPPPLPGSAGIPPPPPPLPG 699 Score = 32.7 bits (71), Expect = 2.4 Identities = 22/74 (29%), Positives = 24/74 (32%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPPPP P PPPP P Sbjct: 666 PPPPPLPGSARI--PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 723 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 724 GGPGIPPP-PPGMG 736 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 704 PPPPPPLPGGPGIPPP-PPFPGG 725 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P + PP GG Sbjct: 601 PPPPPPPPPPLPGGVCISSPPSLPGG 626 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPP 606 >DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. Length = 229 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGG 107 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 72 PPPPPPLPGSAGIPPPPPPLPG 93 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 98 PPPPPPLPGGPGIPPP-PPFPGG 119 Score = 31.1 bits (67), Expect = 7.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPP P P PPPP P Sbjct: 60 PPPPPLPGSARIPPPPPPLPGSAGIP--PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 117 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 118 GGPGIPPP-PPGMG 130 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 691 PPPPPPLPGEAGMPPPPPPLPGG 713 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 678 PPPPPPLPGSAGIPPPPPPLPG 699 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 704 PPPPPPLPGGPGIPPP-PPFPGG 725 Score = 31.1 bits (67), Expect = 7.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPP P P PPPP P Sbjct: 666 PPPPPLPGSARIPPPPPPLPGSAGIP--PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 723 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 724 GGPGIPPP-PPGMG 736 Score = 26.2 bits (55), Expect(2) = 1.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P + PP GG Sbjct: 601 PPPPPPPPPPLPGGVCISSPPSLPGG 626 Score = 25.8 bits (54), Expect(2) = 1.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPP 606 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 701 PPPPPPLPGEAGMPPPPPPLPGG 723 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 688 PPPPPPLPGSAGIPPPPPPLPG 709 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 714 PPPPPPLPGGPGIPPP-PPFPGG 735 Score = 31.1 bits (67), Expect = 7.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPP P P PPPP P Sbjct: 676 PPPPPLPGSARIPPPPPPLPGSAGIP--PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 733 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 734 GGPGIPPP-PPGMG 746 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP PP GG Sbjct: 608 PPPPPPP--------PPPPPPLPGG 624 Score = 27.5 bits (58), Expect(2) = 0.49 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 598 PPPAPGDSTTPPPPPPPPPP 617 Score = 26.2 bits (55), Expect(2) = 0.49 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P + PP GG Sbjct: 611 PPPPPPPPPPLPGGVCISSPPSLPGG 636 Score = 25.8 bits (54), Expect(2) = 0.38 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 597 PPPPAPGDSTTPPPPPPPP 615 Score = 25.4 bits (53), Expect(2) = 5.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 608 PPPPPP-------PPPPPPPLPGG 624 Score = 24.6 bits (51), Expect(2) = 5.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 597 PPPPAPGDSTTPPPPPPPPP 616 >AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. Length = 179 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 85 PPPPPPLPGEAGMPPPPPPLPGG 107 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 72 PPPPPPLPGSAGIPPPPPPLPG 93 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 98 PPPPPPLPGGPGIPPP-PPFPGG 119 Score = 31.1 bits (67), Expect = 7.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPP P P PPPP P Sbjct: 60 PPPPPLPGSARIPPPPPPLPGSAGIP--PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 117 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 118 GGPGIPPP-PPGMG 130 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 36.3 bits (80), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 728 PPPPPPLPGEAGMPPPPPPLPGG 750 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 715 PPPPPPLPGSAGIPPPPPPLPG 736 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P +PPP PP GG Sbjct: 741 PPPPPPLPGGPGIPPP-PPFPGG 762 Score = 31.1 bits (67), Expect = 7.5 Identities = 21/74 (28%), Positives = 23/74 (31%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP G + PPPP P P PPPP P Sbjct: 703 PPPPPLPGSARIPPPPPPLPGSAGIP--PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFP 760 Query: 941 XXXFLPPPXPPXXG 982 +PPP PP G Sbjct: 761 GGPGIPPP-PPGMG 773 Score = 28.3 bits (60), Expect(2) = 0.38 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP PP GG Sbjct: 635 PPPPPPP--------PPPPPPLPGG 651 Score = 27.5 bits (58), Expect(2) = 0.49 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 625 PPPAPGDSTTPPPPPPPPPP 644 Score = 26.2 bits (55), Expect(2) = 0.49 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P + PP GG Sbjct: 638 PPPPPPPPPPLPGGVCISSPPSLPGG 663 Score = 25.8 bits (54), Expect(2) = 0.38 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 624 PPPPAPGDSTTPPPPPPPP 642 Score = 25.4 bits (53), Expect(2) = 5.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 635 PPPPPP-------PPPPPPPLPGG 651 Score = 24.6 bits (51), Expect(2) = 5.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 624 PPPPAPGDSTTPPPPPPPPP 643 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPP 354 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PPPPPPPPLPNQVPPPPPPPP 368 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPP 355 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPP 354 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PPPPPPPPLPNQVPPPPPPPP 368 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPP 355 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPP 354 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PPPPPPPPLPNQVPPPPPPPP 368 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPP 355 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPP 354 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PPPPPPPPLPNQVPPPPPPPP 368 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPP 355 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 334 PGPPPPPPLPSTGPPPPPPPP 354 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PPPPPPPPLPNQVPPPPPPPP 368 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPP 355 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 291 PGPPPPPPLPSTGPPPPPPPP 311 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 305 PPPPPPPPLPNQVPPPPPPPP 325 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 292 GPPPPPPLPSTGPPPPPPPPP 312 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 31.1 bits (67), Expect(2) = 0.24 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP-PXXGGG 988 P PPPPP P PPP P P G G Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPG 48 Score = 26.6 bits (56), Expect(2) = 3.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PP PP Sbjct: 36 PPPPPPAPPPGPGPAPPQHPP 56 Score = 25.8 bits (54), Expect(2) = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 35 PPPPPPPAPPPG---PGPAPP 52 Score = 24.2 bits (50), Expect(2) = 3.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 22 PPPPPPPAPPQQQPPPPPPP 41 Score = 23.8 bits (49), Expect(2) = 0.24 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P G PPPPPP Sbjct: 6 GGGRPGESPGATPAPGPPPPPP 27 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A G PPP PPPPP Sbjct: 19 APGPPPPPPPAPPQQQPPPPPPP 41 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 231 PGPPPPPPLPSTGPPPPPPPP 251 Score = 32.3 bits (70), Expect(2) = 0.24 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 245 PPPPPPPPLPNQVPPPPPPPP 265 Score = 22.6 bits (46), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPP 817 G PPP PPPPP Sbjct: 232 GPPPPPPLPSTGPPPPPPPPP 252 >BC064990-1|AAH64990.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 705 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 747 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 748 TPPVSIPPPHTPP 760 >BC052286-1|AAH52286.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 705 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 747 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 748 TPPVSIPPPHTPP 760 >BC043353-1|AAH43353.1| 1146|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1146 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 705 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 747 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 748 TPPVSIPPPHTPP 760 >BC014921-1|AAH14921.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 705 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 747 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 748 TPPVSIPPPHTPP 760 >AL117417-1|CAB55911.1| 667|Homo sapiens hypothetical protein protein. Length = 667 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 516 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 558 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 559 TPPVSIPPPHTPP 571 >AF023142-1|AAD09327.1| 1157|Homo sapiens pre-mRNA splicing SR protein rA4 protein. Length = 1157 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 715 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 757 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 758 TPPVSIPPPHTPP 770 >AB032998-1|BAA86486.1| 929|Homo sapiens KIAA1172 protein protein. Length = 929 Score = 35.9 bits (79), Expect = 0.26 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G G PPPPPP F F F P PPPP Sbjct: 509 GIPPPGFGPG----VPPPPPPPPFLRPGF-------------NPMHLPPGFLPPGPPPPI 551 Query: 935 XPXXXFLPPPXPP 973 P PP PP Sbjct: 552 TPPVSIPPPHTPP 564 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 31.1 bits (67), Expect(2) = 0.27 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP-PXXGGG 988 P PPPPP P PPP P P G G Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPG 48 Score = 26.6 bits (56), Expect(2) = 3.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PP PP Sbjct: 36 PPPPPPAPPPGPGPAPPQHPP 56 Score = 25.8 bits (54), Expect(2) = 8.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 35 PPPPPPPAPPPG---PGPAPP 52 Score = 24.2 bits (50), Expect(2) = 3.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 22 PPPPPPPAPPQQQPPPPPPP 41 Score = 23.8 bits (49), Expect(2) = 0.27 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P G PPPPPP Sbjct: 6 GGGRPGESPGATPAPGPPPPPP 27 Score = 23.8 bits (49), Expect(2) = 8.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A G PPP PPPPP Sbjct: 19 APGPPPPPPPAPPQQQPPPPPPP 41 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 32.3 bits (70), Expect(2) = 0.29 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPP 939 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPP 940 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPP 941 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPP 942 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPP 943 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPP 944 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPP 945 Score = 22.2 bits (45), Expect(2) = 0.29 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G + PPPPPP Sbjct: 915 GASLPPPPPPPP 926 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 32.3 bits (70), Expect(2) = 0.29 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPP 939 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPP 940 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPP 941 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPP 942 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 923 PPPPPPPPPPPPPPPPPPPPP 943 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 924 PPPPPPPPPPPPPPPPPPPPP 944 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 925 PPPPPPPPPPPPPPPPPPPPP 945 Score = 22.2 bits (45), Expect(2) = 0.29 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G + PPPPPP Sbjct: 915 GASLPPPPPPPP 926 >D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B protein. Length = 79 Score = 32.7 bits (71), Expect(2) = 0.30 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 F P PPPPP P +PPP P G G Sbjct: 45 FVPPPPPPPYGPGR--IPPPPPAPYGPG 70 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 + P P PP+ F+PPP PP G G Sbjct: 30 YPPGPLAPPQPFGPGFVPPPPPPPYGPG 57 Score = 22.2 bits (45), Expect(2) = 0.30 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PP G G V PPPPP Sbjct: 37 PPQPFGPG--FVPPPPPPP 53 >BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland androgen regulated protein 3 homolog B (mouse) protein. Length = 79 Score = 32.7 bits (71), Expect(2) = 0.30 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 F P PPPPP P +PPP P G G Sbjct: 45 FVPPPPPPPYGPGR--IPPPPPAPYGPG 70 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 + P P PP+ F+PPP PP G G Sbjct: 30 YPPGPLAPPQPFGPGFVPPPPPPPYGPG 57 Score = 22.2 bits (45), Expect(2) = 0.30 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PP G G V PPPPP Sbjct: 37 PPQPFGPG--FVPPPPPPP 53 >AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich protein P-B protein. Length = 79 Score = 32.7 bits (71), Expect(2) = 0.30 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 F P PPPPP P +PPP P G G Sbjct: 45 FVPPPPPPPYGPGR--IPPPPPAPYGPG 70 Score = 31.1 bits (67), Expect = 7.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 + P P PP+ F+PPP PP G G Sbjct: 30 YPPGPLAPPQPFGPGFVPPPPPPPYGPG 57 Score = 22.2 bits (45), Expect(2) = 0.30 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PP G G V PPPPP Sbjct: 37 PPQPFGPG--FVPPPPPPP 53 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 33.9 bits (74), Expect(2) = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PSPPPPPPPPASPLPPPPPPP 368 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 347 PPSPPPPPPPPASPLPPPPPP 367 Score = 20.6 bits (41), Expect(2) = 0.31 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 330 PPPRPLPPRPPAAQPPPPP 348 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 33.9 bits (74), Expect(2) = 0.31 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PSPPPPPPPPASPLPPPPPPP 368 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 347 PPSPPPPPPPPASPLPPPPPP 367 Score = 20.6 bits (41), Expect(2) = 0.31 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 330 PPPRPLPPRPPAAQPPPPP 348 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 33.9 bits (74), Expect(2) = 0.33 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 111 PSPPPPPPPPASPLPPPPPPP 131 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 110 PPSPPPPPPPPASPLPPPPPP 130 Score = 20.6 bits (41), Expect(2) = 0.33 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 93 PPPRPLPPRPPAAQPPPPP 111 >EF119711-1|ABO69251.1| 3327|Homo sapiens beta-xin protein. Length = 3327 Score = 35.5 bits (78), Expect = 0.35 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPP---- 928 PPP + P PPPP F P PPPP Sbjct: 2073 PPPPPSNASSEIEFPLPPPPPLMMFPEKNGFLPSLSTEKIKAEFESFPGLPLPPPPVDEK 2132 Query: 929 -PKXPXXXFLPPPXPP 973 + FLPPP PP Sbjct: 2133 SERESSSMFLPPPPPP 2148 >D89501-1|BAA13971.1| 134|Homo sapiens PBI protein. Length = 134 Score = 35.5 bits (78), Expect = 0.35 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 917 PPPPPKXPXXX-FLPPPXPPXXGGG 988 PPPPP+ P F+PPP PP G G Sbjct: 37 PPPPPRFPFGTGFVPPPHPPPYGPG 61 Score = 28.3 bits (60), Expect(2) = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGGG 988 F P P PPP P PPP P G G Sbjct: 49 FVPPPHPPPYGPGR--FPPPLSPPYGPG 74 Score = 22.6 bits (46), Expect(2) = 3.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PP PPP Sbjct: 38 PPPPRFPFGTGFVPPPHPPP 57 >AY820969-1|AAV87913.1| 3345|Homo sapiens CMYA3 protein. Length = 3345 Score = 35.5 bits (78), Expect = 0.35 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPP---- 928 PPP + P PPPP F P PPPP Sbjct: 2120 PPPPPSNASSEIEFPLPPPPPLMMFPEKNGFLPSLSTEKIKAEFESFPGLPLPPPPVDEK 2179 Query: 929 -PKXPXXXFLPPPXPP 973 + FLPPP PP Sbjct: 2180 SERESSSMFLPPPPPP 2195 >AL832331-1|CAD38624.1| 1946|Homo sapiens hypothetical protein protein. Length = 1946 Score = 35.5 bits (78), Expect = 0.35 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 5/76 (6%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPP---- 928 PPP + P PPPP F P PPPP Sbjct: 1682 PPPPPSNASSEIEFPLPPPPPLMMFPEKNGFLPSLSTEKIKAEFESFPGLPLPPPPVDEK 1741 Query: 929 -PKXPXXXFLPPPXPP 973 + FLPPP PP Sbjct: 1742 SERESSSMFLPPPPPP 1757 >AF110377-1|AAD04629.1| 3859|Homo sapiens PCAF-associated factor 400 protein. Length = 3859 Score = 31.1 bits (67), Expect(2) = 0.35 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 506 PPPPPPPPPPATPVTPAPVPP 526 Score = 23.0 bits (47), Expect(2) = 0.35 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A P P PPPPPP Sbjct: 490 APAAPGPAPSPAPVPAPPPPPPPP 513 >AF076974-1|AAD09420.1| 3830|Homo sapiens TRRAP protein protein. Length = 3830 Score = 31.1 bits (67), Expect(2) = 0.35 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 506 PPPPPPPPPPATPVTPAPVPP 526 Score = 23.0 bits (47), Expect(2) = 0.35 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A P P PPPPPP Sbjct: 490 APAAPGPAPSPAPVPAPPPPPPPP 513 >AB209489-1|BAD92726.1| 3587|Homo sapiens Transformation/transcription domain-associated protein variant protein. Length = 3587 Score = 31.1 bits (67), Expect(2) = 0.36 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 220 PPPPPPPPPPATPVTPAPVPP 240 Score = 23.0 bits (47), Expect(2) = 0.36 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A P P PPPPPP Sbjct: 204 APAAPGPAPSPAPVPAPPPPPPPP 227 >AC004991-1|AAC27675.2| 2089|Homo sapiens unknown protein. Length = 2089 Score = 31.1 bits (67), Expect(2) = 0.37 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P P PP Sbjct: 506 PPPPPPPPPPATPVTPAPVPP 526 Score = 23.0 bits (47), Expect(2) = 0.37 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A P P PPPPPP Sbjct: 490 APAAPGPAPSPAPVPAPPPPPPPP 513 >AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens cDNA FLJ13283 fis, clone OVARC1001113, highly similar to Homo sapiens diaphanous 1 (HDIA1) mRNA. ). Length = 533 Score = 28.3 bits (60), Expect(2) = 0.40 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP PPP PP GG Sbjct: 375 PPPPPPP--------PPPPPPLPGG 391 Score = 27.5 bits (58), Expect(2) = 0.52 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 365 PPPAPGDSTTPPPPPPPPPP 384 Score = 26.2 bits (55), Expect(2) = 0.52 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P + PP GG Sbjct: 378 PPPPPPPPPPLPGGVCISSPPSLPGG 403 Score = 25.8 bits (54), Expect(2) = 0.40 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 364 PPPPAPGDSTTPPPPPPPP 382 Score = 25.4 bits (53), Expect(2) = 5.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 375 PPPPPP-------PPPPPPPLPGG 391 Score = 24.6 bits (51), Expect(2) = 5.5 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 364 PPPPAPGDSTTPPPPPPPPP 383 Score = 24.6 bits (51), Expect(3) = 7.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 794 PXPPPPPXXGG 762 P PPPPP GG Sbjct: 381 PPPPPPPLPGG 391 Score = 21.8 bits (44), Expect(3) = 7.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 Query: 788 PPPPPXXGGGXPXP 747 PPPP G G P P Sbjct: 420 PPPPLPEGVGIPSP 433 Score = 21.4 bits (43), Expect(3) = 7.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 Query: 812 GGGXKXPXPPPPP 774 G P PPPPP Sbjct: 370 GDSTTPPPPPPPP 382 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 29.9 bits (64), Expect(2) = 0.49 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P LPPP Sbjct: 1412 PPPPPPPPPPPQQPLPPP 1429 Score = 28.7 bits (61), Expect(2) = 3.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP P PPP Sbjct: 1413 PPPPPPPPPPQQPLPPPP 1430 Score = 23.8 bits (49), Expect(2) = 0.49 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 1398 PPSGGPPEAPPAQPPPPPP 1416 Score = 21.8 bits (44), Expect(2) = 3.9 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 1398 PPSGGPPEAPPAQPPPPPPP 1417 >AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1193 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 567 PPPLPSGGGVPPPPPPPPPP 586 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 566 PPPPLPSGGGVPPPPPPPPP 585 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 565 PPPPPLPSGGGVPPPPPP 582 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 581 PPPPPPPLPGMRMPFSGPVPPPPPLG 606 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 552 PPSKEGGTGHSALPPPPPLP 571 >AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 567 PPPLPSGGGVPPPPPPPPPP 586 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 566 PPPPLPSGGGVPPPPPPPPP 585 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 565 PPPPPLPSGGGVPPPPPP 582 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 581 PPPPPPPLPGMRMPFSGPVPPPPPLG 606 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 552 PPSKEGGTGHSALPPPPPLP 571 >AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 567 PPPLPSGGGVPPPPPPPPPP 586 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 566 PPPPLPSGGGVPPPPPPPPP 585 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 565 PPPPPLPSGGGVPPPPPP 582 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 581 PPPPPPPLPGMRMPFSGPVPPPPPLG 606 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 552 PPSKEGGTGHSALPPPPPLP 571 >AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1182 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 567 PPPLPSGGGVPPPPPPPPPP 586 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 566 PPPPLPSGGGVPPPPPPPPP 585 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 565 PPPPPLPSGGGVPPPPPP 582 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 581 PPPPPPPLPGMRMPFSGPVPPPPPLG 606 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 552 PPSKEGGTGHSALPPPPPLP 571 >AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous homologue 2 protein. Length = 1182 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 567 PPPLPSGGGVPPPPPPPPPP 586 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 566 PPPPLPSGGGVPPPPPPPPP 585 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 565 PPPPPLPSGGGVPPPPPP 582 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 581 PPPPPPPLPGMRMPFSGPVPPPPPLG 606 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 552 PPSKEGGTGHSALPPPPPLP 571 >AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 protein. Length = 1152 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 532 PPPLPSGGGVPPPPPPPPPP 551 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 531 PPPPLPSGGGVPPPPPPPPP 550 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 530 PPPPPLPSGGGVPPPPPP 547 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 546 PPPPPPPLPGMRMPFSGPVPPPPPLG 571 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 517 PPSKEGGTGHSALPPPPPLP 536 >AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 532 PPPLPSGGGVPPPPPPPPPP 551 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 531 PPPPLPSGGGVPPPPPPPPP 550 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 530 PPPPPLPSGGGVPPPPPP 547 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 546 PPPPPPPLPGMRMPFSGPVPPPPPLG 571 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 517 PPSKEGGTGHSALPPPPPLP 536 >AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 532 PPPLPSGGGVPPPPPPPPPP 551 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 531 PPPPLPSGGGVPPPPPPPPP 550 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 530 PPPPPLPSGGGVPPPPPP 547 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 546 PPPPPPPLPGMRMPFSGPVPPPPPLG 571 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 517 PPSKEGGTGHSALPPPPPLP 536 >AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1147 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 532 PPPLPSGGGVPPPPPPPPPP 551 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 531 PPPPLPSGGGVPPPPPPPPP 550 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 530 PPPPPLPSGGGVPPPPPP 547 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 546 PPPPPPPLPGMRMPFSGPVPPPPPLG 571 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 517 PPSKEGGTGHSALPPPPPLP 536 >AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous homologue 2_splice_variant1 protein. Length = 1147 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 532 PPPLPSGGGVPPPPPPPPPP 551 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 531 PPPPLPSGGGVPPPPPPPPP 550 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 530 PPPPPLPSGGGVPPPPPP 547 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 546 PPPPPPPLPGMRMPFSGPVPPLPPLG 571 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 517 PPSKEGGTGHSALPPPPPLP 536 >AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 508 PPPLPSGGGVPPPPPPPPPP 527 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 507 PPPPLPSGGGVPPPPPPPPP 526 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 506 PPPPPLPSGGGVPPPPPP 523 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 522 PPPPPPPLPGMRMPFSGPVPPPPPLG 547 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 493 PPSKEGGTGHSALPPPPPLP 512 >AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 508 PPPLPSGGGVPPPPPPPPPP 527 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 507 PPPPLPSGGGVPPPPPPPPP 526 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 506 PPPPPLPSGGGVPPPPPP 523 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 522 PPPPPPPLPGMRMPFSGPVPPPPPLG 547 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 493 PPSKEGGTGHSALPPPPPLP 512 >AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 508 PPPLPSGGGVPPPPPPPPPP 527 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 507 PPPPLPSGGGVPPPPPPPPP 526 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 506 PPPPPLPSGGGVPPPPPP 523 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 522 PPPPPPPLPGMRMPFSGPVPPPPPLG 547 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 493 PPSKEGGTGHSALPPPPPLP 512 >AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1123 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 508 PPPLPSGGGVPPPPPPPPPP 527 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 507 PPPPLPSGGGVPPPPPPPPP 526 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 506 PPPPPLPSGGGVPPPPPP 523 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 522 PPPPPPPLPGMRMPFSGPVPPPPPLG 547 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 493 PPSKEGGTGHSALPPPPPLP 512 >AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous homologue 2_splice_variant2 protein. Length = 1123 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 508 PPPLPSGGGVPPPPPPPPPP 527 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 507 PPPPLPSGGGVPPPPPPPPP 526 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 506 PPPPPLPSGGGVPPPPPP 523 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 522 PPPPPPPLPGMRMPFSGPVPPPPPLG 547 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 493 PPSKEGGTGHSALPPPPPLP 512 >AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related formin 3 protein. Length = 1112 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 1112 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.50 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.50 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 315 PPPLPSGGGVPPPPPPPPPP 334 Score = 29.9 bits (64), Expect(2) = 0.51 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 314 PPPPLPSGGGVPPPPPPPPP 333 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 313 PPPPPLPSGGGVPPPPPP 330 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 329 PPPPPPPLPGMRMPFSGPVPPPPPLG 354 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 300 PPSKEGGTGHSALPPPPPLP 319 >BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 315 PPPLPSGGGVPPPPPPPPPP 334 Score = 29.9 bits (64), Expect(2) = 0.51 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 314 PPPPLPSGGGVPPPPPPPPP 333 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 313 PPPPPLPSGGGVPPPPPP 330 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 329 PPPPPPPLPGMRMPFSGPVPPPPPLG 354 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 300 PPSKEGGTGHSALPPPPPLP 319 >BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 315 PPPLPSGGGVPPPPPPPPPP 334 Score = 29.9 bits (64), Expect(2) = 0.51 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 314 PPPPLPSGGGVPPPPPPPPP 333 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 313 PPPPPLPSGGGVPPPPPP 330 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 329 PPPPPPPLPGMRMPFSGPVPPPPPLG 354 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 300 PPSKEGGTGHSALPPPPPLP 319 >BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. Length = 802 Score = 29.5 bits (63), Expect(2) = 0.51 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP---PPXPPXXGGG 988 P PPPPP P P PP PP G Sbjct: 156 PPPPPPPPPPASAAAPASGPPAPPGLAAG 184 Score = 24.2 bits (50), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 145 PPPPPPATAAPPPPPPPPPP 164 >Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 protein. Length = 729 Score = 29.5 bits (63), Expect(2) = 0.51 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP---PPXPPXXGGG 988 P PPPPP P P PP PP G Sbjct: 83 PPPPPPPPPPASAAAPASGPPAPPGLAAG 111 Score = 24.2 bits (50), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 71 PPPPPPPATAAPPPPPPPPP 90 >AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 protein. Length = 729 Score = 29.5 bits (63), Expect(2) = 0.51 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP---PPXPPXXGGG 988 P PPPPP P P PP PP G Sbjct: 83 PPPPPPPPPPASAAAPASGPPAPPGLAAG 111 Score = 24.2 bits (50), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 71 PPPPPPPATAAPPPPPPPPP 90 >AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. Length = 729 Score = 29.5 bits (63), Expect(2) = 0.51 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP---PPXPPXXGGG 988 P PPPPP P P PP PP G Sbjct: 83 PPPPPPPPPPASAAAPASGPPAPPGLAAG 111 Score = 24.2 bits (50), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 71 PPPPPPPATAAPPPPPPPPP 90 >AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens cDNA FLJ34705 fis, clone MESAN2003035, highly similar to Mus musculus diaphanous-related formin (Dia2) mRNA. ). Length = 699 Score = 31.1 bits (67), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG + PPPPPP Sbjct: 577 PPPPLPSGGGVLPPPPPPPP 596 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVLPPPPPPPPP 597 Score = 30.3 bits (65), Expect(2) = 0.51 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP LPPP PP Sbjct: 576 PPPPPLPSGGGVLPPPPPP 594 Score = 29.9 bits (64), Expect(2) = 0.51 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVLPPPPPPPP 596 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 0.51 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein protein. Length = 669 Score = 30.7 bits (66), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP GG PPPPPP Sbjct: 578 PPPLPSGGGVPPPPPPPPPP 597 Score = 29.9 bits (64), Expect(2) = 0.51 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP GG PPPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPP 596 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP PP Sbjct: 576 PPPPPLPSGGGVPPPPPP 593 Score = 23.8 bits (49), Expect(2) = 0.51 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFS--XPPXPPXG 980 P PPPP FS PP PP G Sbjct: 592 PPPPPPPLPGMRMPFSGPVPPPPPLG 617 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPP P Sbjct: 563 PPSKEGGTGHSALPPPPPLP 582 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 583 PLPPPPPPLPGMMGIPPPPPP 603 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 570 PPPPPAPPLPGGAPLPPPPPPLPG 593 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 571 PPPPAPPLPGGAPLPPPPPP 590 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 583 PLPPPPPPLPGMMGIPPPPPPPLLFGG 609 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 34.7 bits (76), Expect = 0.61 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +PPP PP Sbjct: 576 PLPPPPPPLPGMMGIPPPPPP 596 Score = 33.5 bits (73), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P P LPPP PP G Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPG 586 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPP 818 PPPP G PPPPP Sbjct: 564 PPPPAPPLPGGAPLPPPPPP 583 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 909 PXXPPPPQXXRGXFFSXPPXPPXGGGG 989 P PPPP PP PP GG Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 34.7 bits (76), Expect = 0.61 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G PPPP P F + PPPP Sbjct: 3 GIPPPPPPVGFGSPGTPPPPSPPSFP------PHPDFAAPPPPPPPPAADYPTLPPPPLS 56 Query: 935 XPXXXFLPPPXPPXXG 982 P PPP PP G Sbjct: 57 QPTGGAPPPPPPPPPG 72 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 29.1 bits (62), Expect(2) = 0.70 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P LPP P G Sbjct: 174 PGPPPPPGPPPPPGLPPSGVPAAAHG 199 Score = 24.2 bits (50), Expect(2) = 0.70 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 +++ A G P P G PPPP P Sbjct: 153 ERRVSNAGGPPAPPAGGPPPPPGPPPPPGP 182 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 29.1 bits (62), Expect(2) = 0.70 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P LPP P G Sbjct: 174 PGPPPPPGPPPPPGLPPSGVPAAAHG 199 Score = 24.2 bits (50), Expect(2) = 0.70 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 +++ A G P P G PPPP P Sbjct: 153 ERRVSNAGGPPAPPAGGPPPPPGPPPPPGP 182 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 29.1 bits (62), Expect(2) = 0.70 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P LPP P G Sbjct: 175 PGPPPPPGPPPPPGLPPSGVPAAAHG 200 Score = 24.2 bits (50), Expect(2) = 0.70 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 +++ A G P P G PPPP P Sbjct: 154 ERRVSNAGGPPAPPAGGPPPPPGPPPPPGP 183 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 29.1 bits (62), Expect(2) = 0.70 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P LPP P G Sbjct: 172 PGPPPPPGPPPPPGLPPSGVPAAAHG 197 Score = 24.2 bits (50), Expect(2) = 0.70 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 +++ A G P P G PPPP P Sbjct: 151 ERRVSNAGGPPAPPAGGPPPPPGPPPPPGP 180 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 34.3 bits (75), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG + PPPPPP Sbjct: 382 PPPPPGAGGPPMPPPPPPPP 401 Score = 32.3 bits (70), Expect = 3.2 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G GG PPPPPP L P PPPPP Sbjct: 358 GPPPP--GRGGP----PPPPPPATGRSGPLPPPPPGAGGPPMPPP-------PPPPPPPP 404 Query: 935 XPXXXFLPPPXPP 973 PPP PP Sbjct: 405 SSGNGPAPPPLPP 417 Score = 31.5 bits (68), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP LPPP PP GG Sbjct: 367 PPPPPPPATGRSGPLPPP-PPGAGG 390 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 34.3 bits (75), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG + PPPPPP Sbjct: 382 PPPPPGAGGPPMPPPPPPPP 401 Score = 32.3 bits (70), Expect = 3.2 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G GG PPPPPP L P PPPPP Sbjct: 358 GPPPP--GRGGP----PPPPPPATGRSGPLPPPPPGAGGPPMPPP-------PPPPPPPP 404 Query: 935 XPXXXFLPPPXPP 973 PPP PP Sbjct: 405 SSGNGPAPPPLPP 417 Score = 31.5 bits (68), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP LPPP PP GG Sbjct: 367 PPPPPPPATGRSGPLPPP-PPGAGG 390 >BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. Length = 418 Score = 34.3 bits (75), Expect = 0.80 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PPP PP GG Sbjct: 186 PPPPPPVPPPPTGATPPPPPPLPAGG 211 >BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. Length = 416 Score = 34.3 bits (75), Expect = 0.80 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PPP PP GG Sbjct: 184 PPPPPPVPPPPTGATPPPPPPLPAGG 209 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 34.3 bits (75), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG + PPPPPP Sbjct: 382 PPPPPGAGGPPMPPPPPPPP 401 Score = 32.3 bits (70), Expect = 3.2 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G GG PPPPPP L P PPPPP Sbjct: 358 GPPPP--GRGGP----PPPPPPATGRSGPLPPPPPGAGGPPMPPP-------PPPPPPPP 404 Query: 935 XPXXXFLPPPXPP 973 PPP PP Sbjct: 405 SSGNGPAPPPLPP 417 Score = 31.5 bits (68), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP LPPP PP GG Sbjct: 367 PPPPPPPATGRSGPLPPP-PPGAGG 390 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 34.3 bits (75), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG + PPPPPP Sbjct: 394 PPPPPGAGGPPMPPPPPPPP 413 Score = 32.3 bits (70), Expect = 3.2 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G GG PPPPPP L P PPPPP Sbjct: 370 GPPPP--GRGGP----PPPPPPATGRSGPLPPPPPGAGGPPMPPP-------PPPPPPPP 416 Query: 935 XPXXXFLPPPXPP 973 PPP PP Sbjct: 417 SSGNGPAPPPLPP 429 Score = 31.5 bits (68), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP LPPP PP GG Sbjct: 379 PPPPPPPATGRSGPLPPP-PPGAGG 402 >AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP like protein protein. Length = 362 Score = 34.3 bits (75), Expect = 0.80 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PPP PP GG Sbjct: 130 PPPPPPVPPPPTGATPPPPPPLPAGG 155 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 34.3 bits (75), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G GG + PPPPPP Sbjct: 382 PPPPPGAGGPPMPPPPPPPP 401 Score = 32.3 bits (70), Expect = 3.2 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G GG PPPPPP L P PPPPP Sbjct: 358 GPPPP--GRGGP----PPPPPPATGRSGPLPPPPPGAGGPPMPPP-------PPPPPPPP 404 Query: 935 XPXXXFLPPPXPP 973 PPP PP Sbjct: 405 SSGNGPAPPPLPP 417 Score = 31.5 bits (68), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP LPPP PP GG Sbjct: 367 PPPPPPPATGRSGPLPPP-PPGAGG 390 >AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. Length = 418 Score = 34.3 bits (75), Expect = 0.80 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PPP PP GG Sbjct: 186 PPPPPPVPPPPTGATPPPPPPLPAGG 211 >AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. Length = 418 Score = 34.3 bits (75), Expect = 0.80 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PPP PP GG Sbjct: 186 PPPPPPVPPPPTGATPPPPPPLPAGG 211 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 34.3 bits (75), Expect = 0.80 Identities = 26/83 (31%), Positives = 27/83 (32%), Gaps = 3/83 (3%) Frame = +2 Query: 725 KXKKKXKXAX---GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXX 895 + KKK K A G PPP PPPPPP L Sbjct: 926 RKKKKGKEAGPGAGLPPPRAPALPSEARAPPPPPPPP-PHPPLPPPPLPPPPLPLRLPPL 984 Query: 896 XXXFXPXPPPPPKXPXXXFLPPP 964 P P PPP P LPPP Sbjct: 985 PPPPLPRPHPPPPPPLPPLLPPP 1007 Score = 31.5 bits (68), Expect = 5.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 956 PPPPPPPPHPPLPPPPLPP 974 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PSPPPPPPPPASPLPPPPPPP 368 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 347 PPSPPPPPPPPASPLPPPPPP 367 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 348 PSPPPPPPPPASPLPPPPPPP 368 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 347 PPSPPPPPPPPASPLPPPPPP 367 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 33.9 bits (74), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 12 PAPPPPPPQPQPQ--PPPPPPGPGAG 35 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 33.9 bits (74), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 12 PAPPPPPPQPQPQ--PPPPPPGPGAG 35 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 F P P PPP P +PPP PP G Sbjct: 316 FAPPPAPPPPPPPMIGIPPPPPPVGFG 342 Score = 31.5 bits (68), Expect = 5.6 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPP 922 K PP + PPPPPP F P PP Sbjct: 313 KPGFAPPPAPPPPPPPMIGIPPPPPPVGFG-----SPGTPPPPSPPSFPPHPDFAAPPPP 367 Query: 923 PPPKXPXXXFLPPPXPPXXGGG 988 PPP LPPP GG Sbjct: 368 PPPPAADYPTLPPPPLSQPTGG 389 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PPP PP G Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPLPG 493 Score = 33.1 bits (72), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP G Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPLPG 493 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 467 PMPPPPPPPPPPPPPPPPPPP 487 Score = 26.2 bits (55), Expect(2) = 6.9 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P PP Sbjct: 483 PPPPPPPPLPGPAAETVPAPP 503 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPP 490 >AL833083-1|CAD89973.1| 1067|Homo sapiens hypothetical protein protein. Length = 1067 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP PP GG Sbjct: 541 PPPPPPLPFACCPPPPPPPLPPGG 564 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G G Sbjct: 553 PPPPPPPLPPGGPPTPPGAPPCLGMG 578 >AL590999-1|CAI16176.2| 1068|Homo sapiens dishevelled associated activator of morphogenesis protein. Length = 1068 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP PP GG Sbjct: 541 PPPPPPLPFACCPPPPPPPLPPGG 564 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G G Sbjct: 553 PPPPPPPLPPGGPPTPPGAPPCLGMG 578 >AL357412-1|CAI23288.2| 1068|Homo sapiens dishevelled associated activator of morphogenesisorax homolog, Drosophila); tra protein. Length = 1068 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP PP GG Sbjct: 541 PPPPPPLPFACCPPPPPPPLPPGG 564 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G G Sbjct: 553 PPPPPPPLPPGGPPTPPGAPPCLGMG 578 >AL136089-1|CAI20010.2| 1068|Homo sapiens dishevelled associated activator of morphogenesisacetylgalactosaminyltransferas protein. Length = 1068 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP PP GG Sbjct: 541 PPPPPPLPFACCPPPPPPPLPPGG 564 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G G Sbjct: 553 PPPPPPPLPPGGPPTPPGAPPCLGMG 578 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 F P P PPP P +PPP PP G Sbjct: 316 FAPPPAPPPPPPPMIGIPPPPPPVGFG 342 Score = 31.5 bits (68), Expect = 5.6 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPP 922 K PP + PPPPPP F P PP Sbjct: 313 KPGFAPPPAPPPPPPPMIGIPPPPPPVGFG-----SPGTPPPPSPPSFPPHPDFAAPPPP 367 Query: 923 PPPKXPXXXFLPPPXPPXXGGG 988 PPP LPPP GG Sbjct: 368 PPPPAADYPTLPPPPLSQPTGG 389 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 159 PSPPPPPPPPPSPLPPPPPPP 179 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P LPPP PP Sbjct: 158 PPSPPPPPPPPPSPLPPPPPP 178 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 F P P PPP P +PPP PP G Sbjct: 444 FAPPPAPPPPPPPMIGIPPPPPPIGFG 470 Score = 31.5 bits (68), Expect = 5.6 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G PPPP F + PPPP Sbjct: 459 GIPPPPPPIGFGSPGTPPPPSSPSFP------PHPDFAAPPPLPPPPAADYPTLPPPPLS 512 Query: 935 XPXXXFLPPPXPPXXG 982 P PPP PP G Sbjct: 513 QPTRGAPPPPPPPPPG 528 >AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein protein. Length = 502 Score = 33.9 bits (74), Expect = 1.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 12 PAPPPPPPQPQPQ--PPPPPPGPGAG 35 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 F P P PPP P +PPP PP G Sbjct: 315 FAPPPAPPPPPPPMIGIPPPPPPIGFG 341 Score = 31.5 bits (68), Expect = 5.6 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G PPPP F + PPPP Sbjct: 330 GIPPPPPPIGFGSPGTPPPPSSPSFP------PHPDFAAPPPLPPPPAADYPTLPPPPLS 383 Query: 935 XPXXXFLPPPXPPXXG 982 P PPP PP G Sbjct: 384 QPTRGAPPPPPPPPPG 399 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PPP PP G Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPLPG 596 Score = 33.1 bits (72), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP G Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPLPG 596 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 570 PMPPPPPPPPPPPPPPPPPPP 590 Score = 26.2 bits (55), Expect(2) = 6.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P P PP Sbjct: 586 PPPPPPPPLPGPASETVPAPP 606 Score = 23.4 bits (48), Expect(2) = 6.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPP 593 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 F P P PPP P +PPP PP G Sbjct: 316 FAPPPAPPPPPPPMIGIPPPPPPVGFG 342 Score = 31.5 bits (68), Expect = 5.6 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPP 922 K PP + PPPPPP F P PP Sbjct: 313 KPGFAPPPAPPPPPPPMIGIPPPPPPVGFG-----SPGTPPPPSPPSFPPHPDFAAPPPP 367 Query: 923 PPPKXPXXXFLPPPXPPXXGGG 988 PPP LPPP GG Sbjct: 368 PPPPAADYPTLPPPPLSQPTGG 389 >AB002379-1|BAA20835.2| 1114|Homo sapiens KIAA0381 protein protein. Length = 1114 Score = 33.9 bits (74), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PPP PP GG Sbjct: 587 PPPPPPLPFACCPPPPPPPLPPGG 610 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G G Sbjct: 599 PPPPPPPLPPGGPPTPPGAPPCLGMG 624 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 33.5 bits (73), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 598 PPPPPPPPLPEAASSPPPAPP 618 Score = 27.5 bits (58), Expect(2) = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPP--PPPKXPXXXFLPPPXP 970 P PP PPP P LPPP P Sbjct: 432 PPPPSFPPPPPPPGTQLPPPPP 453 Score = 23.0 bits (47), Expect(2) = 4.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 803 PPPPPPXF 826 PPPPPP F Sbjct: 430 PPPPPPSF 437 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 33.5 bits (73), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 469 PPPPPPPPLPEAASSPPPVPP 489 Score = 27.5 bits (58), Expect(2) = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPP--PPPKXPXXXFLPPPXP 970 P PP PPP P LPPP P Sbjct: 334 PPPPSFPPPPPPPGTQLPPPPP 355 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 803 PPPPPPXF 826 PPPPPP F Sbjct: 332 PPPPPPSF 339 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 33.5 bits (73), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 598 PPPPPPPPLPEAASSPPPAPP 618 Score = 27.5 bits (58), Expect(2) = 4.1 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPP--PPPKXPXXXFLPPPXP 970 P PP PPP P LPPP P Sbjct: 432 PPPPSFPPPPPPPGTQLPPPPP 453 Score = 23.0 bits (47), Expect(2) = 4.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 803 PPPPPPXF 826 PPPPPP F Sbjct: 430 PPPPPPSF 437 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 33.5 bits (73), Expect = 1.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 469 PPPPPPPPLPEAASSPPPVPP 489 Score = 27.5 bits (58), Expect(2) = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPP--PPPKXPXXXFLPPPXP 970 P PP PPP P LPPP P Sbjct: 334 PPPPSFPPPPPPPGTQLPPPPP 355 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 803 PPPPPPXF 826 PPPPPP F Sbjct: 332 PPPPPPSF 339 >AF112209-1|AAF17197.1| 416|Homo sapiens Ena-VASP-like protein protein. Length = 416 Score = 31.1 bits (67), Expect(2) = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PP PP GG Sbjct: 184 PPPPPPVPPPPTGATPPSPPPLPAGG 209 Score = 30.7 bits (66), Expect = 9.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PP PP G Sbjct: 183 PPPPPPPVPPPPTGATPPSPPPLPAG 208 Score = 21.0 bits (42), Expect(2) = 1.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 182 PPPPPP 187 >EF078888-1|ABK41959.1| 355|Homo sapiens Kruppel-like factor 2 (lung) protein. Length = 355 Score = 28.3 bits (60), Expect(2) = 1.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >BC071983-1|AAH71983.1| 355|Homo sapiens Kruppel-like factor 2 (lung) protein. Length = 355 Score = 28.3 bits (60), Expect(2) = 1.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >AF205849-1|AAF13295.1| 355|Homo sapiens Kruppel-like factor protein. Length = 355 Score = 28.3 bits (60), Expect(2) = 1.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >AF134053-1|AAD55891.1| 355|Homo sapiens Kruppel-like factor LKLF protein. Length = 355 Score = 28.3 bits (60), Expect(2) = 1.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >AF123344-1|AAD25076.1| 355|Homo sapiens Kruppel-like zinc finger transcription factor protein. Length = 355 Score = 28.3 bits (60), Expect(2) = 1.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >BC063682-1|AAH63682.1| 264|Homo sapiens FAM39DP protein protein. Length = 264 Score = 30.3 bits (65), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 104 PPPPPPPPAPEVLASAPPLPP 124 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G PPPPPP Sbjct: 98 GVLTPPPPPPPP 109 >AY341937-1|AAQ76876.1| 264|Homo sapiens CXYorf1 protein. Length = 264 Score = 30.3 bits (65), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 104 PPPPPPPPAPEVLASAPPLPP 124 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G PPPPPP Sbjct: 98 GVLTPPPPPPPP 109 >AY341936-1|AAQ76875.1| 264|Homo sapiens CXYorf1 protein. Length = 264 Score = 30.3 bits (65), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 104 PPPPPPPPAPEVLASAPPLPP 124 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 785 GXXVXXPPPPPP 820 G PPPPPP Sbjct: 98 GVLTPPPPPPPP 109 >BC035342-1|AAH35342.1| 224|Homo sapiens Similar to Kruppel-like factor 2 (lung) protein. Length = 224 Score = 28.3 bits (60), Expect(2) = 1.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P PP Sbjct: 62 PEPPPPPPPPAFYYPEPGAPP 82 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G G PPPPPP Sbjct: 55 GLGAEAAPEPPPPPP 69 >AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ14966 fis, clone THYRO1000034, weakly similar to TRICHOHYALIN. ). Length = 509 Score = 33.1 bits (72), Expect = 1.8 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP GG Sbjct: 268 PPPPPPPPPPP----PPPPPPTAGG 288 >AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. Length = 1822 Score = 33.1 bits (72), Expect = 1.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP GG + PPPPP Sbjct: 84 PPLPPPPVMPGGGYGDWQPPPPP 106 Score = 32.7 bits (71), Expect = 2.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 760 PPPXXGGGGGXGXFXPPPPP 819 PPP GGG G + PPPPP Sbjct: 87 PPPPVMPGGGYGDWQPPPPP 106 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP V PPPPPP Sbjct: 316 PPPPSEKKPEKVTPPPPPPP 335 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 329 PPPPPPPPPP-----PPPPP 343 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP V PPPPPP Sbjct: 316 PPPPSEKKPEKVTPPPPPPP 335 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 329 PPPPPPPPPP-----PPPPP 343 >BC000401-1|AAH00401.2| 894|Homo sapiens SF3B2 protein protein. Length = 894 Score = 26.6 bits (56), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 92 PPPPLGLPPLQPPPPPPPPP 111 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PP G Sbjct: 104 PPPPPPPPPGLGLGFPMAHPPNLG 127 >BC053577-1|AAH53577.1| 877|Homo sapiens SF3B2 protein protein. Length = 877 Score = 26.6 bits (56), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 93 PPPPLGLPPLQPPPPPPPPP 112 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PP G Sbjct: 105 PPPPPPPPPGLGLGFPMAHPPNLG 128 >U41371-1|AAA97461.1| 872|Homo sapiens spliceosome associated protein protein. Length = 872 Score = 26.6 bits (56), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 70 PPPPLGLPPLQPPPPPPPPP 89 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PP G Sbjct: 82 PPPPPPPPPGLGLGFPMAHPPNLG 105 >BX537771-1|CAD97834.1| 799|Homo sapiens hypothetical protein protein. Length = 799 Score = 26.6 bits (56), Expect(2) = 1.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 95 PPPPLGLPPLQPPPPPPPPP 114 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PP G Sbjct: 107 PPPPPPPPPGLGLGFPMAHPPNLG 130 >U87166-1|AAC39757.1| 508|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 508 Score = 30.7 bits (66), Expect(2) = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 396 PPPPPPDDIPMFDDFPPPPPP 416 Score = 21.0 bits (42), Expect(2) = 2.0 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 395 PPPPPP 400 >AF540955-1|AAN28379.1| 476|Homo sapiens Abl-interactor 1 protein. Length = 476 Score = 30.7 bits (66), Expect(2) = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 364 PPPPPPDDIPMFDDFPPPPPP 384 Score = 21.0 bits (42), Expect(2) = 2.0 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 363 PPPPPP 368 >BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IMAGE:3895048) protein. Length = 205 Score = 26.6 bits (56), Expect(2) = 2.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PPP G PPPPPP Sbjct: 10 AQADPPPPPTALGFGPGKPPPPPP 33 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP PPP Sbjct: 29 PPPPPPPAGGGPGTAPPP 46 >BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subunit 19 protein. Length = 194 Score = 26.6 bits (56), Expect(2) = 2.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PPP G PPPPPP Sbjct: 10 AQADPPPPPTALGFGPGKPPPPPP 33 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPP 964 P PPPPP PPP Sbjct: 29 PPPPPPPAGGGPGTAPPP 46 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP+ P PPP PP G Sbjct: 746 PPPPPPPESPPPP--PPPPPPAEDG 768 Score = 29.9 bits (64), Expect(2) = 2.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P +PPP G Sbjct: 941 PPPPPPPPPPPAPKMPPPEKTKKG 964 Score = 21.4 bits (43), Expect(2) = 2.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 935 IIEPPPPPP 943 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP+ P PPP PP G Sbjct: 711 PPPPPPPESPPPP--PPPPPPAEDG 733 Score = 29.9 bits (64), Expect(2) = 2.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P +PPP G Sbjct: 906 PPPPPPPPPPPAPKMPPPEKTKKG 929 Score = 21.4 bits (43), Expect(2) = 2.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 900 IIEPPPPPP 908 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 32.7 bits (71), Expect = 2.4 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPP 931 PPP G G PPPPPP F+ P PPPPP Sbjct: 586 PPPPPGSAGMMYAPPPPPPPPMDPSNFV------TMMGMGVAGMPPFGMPPAPPPPP 636 Score = 32.3 bits (70), Expect = 3.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PPP PP Sbjct: 584 PPPPPPPGSAGMMYAPPPPPP 604 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 582 PPPPPPPPPGSAGMMYAPPPPPP 604 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 32.7 bits (71), Expect = 2.4 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPP 931 PPP G G PPPPPP F+ P PPPPP Sbjct: 212 PPPPPGSAGMMYAPPPPPPPPMDPSNFV------TMMGMGVAGMPPFGMPPAPPPPP 262 Score = 32.3 bits (70), Expect = 3.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PPP PP Sbjct: 210 PPPPPPPGSAGMMYAPPPPPP 230 Score = 31.9 bits (69), Expect = 4.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 208 PPPPPPPPPGSAGMMYAPPPPPP 230 >AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. Length = 659 Score = 32.7 bits (71), Expect = 2.4 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP GG Sbjct: 19 PQPPPPPPPP-----PPPLPPPSGG 38 >BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. Length = 688 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 25 PPPPPPPPPPPPLPDPTPP 43 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 23 VPPPPPPPP 31 >BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 protein. Length = 688 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 25 PPPPPPPPPPPPLPDPTPP 43 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 23 VPPPPPPPP 31 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 25 PPPPPPPPPPPPLPDPTPP 43 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 23 VPPPPPPPP 31 >AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 protein. Length = 675 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 12 PPPPPPPPPPPPLPDPTPP 30 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 10 VPPPPPPPP 18 >AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a protein. Length = 675 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 12 PPPPPPPPPPPPLPDPTPP 30 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 10 VPPPPPPPP 18 >AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 isoform c protein. Length = 546 Score = 29.5 bits (63), Expect(2) = 2.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LP P PP Sbjct: 25 PPPPPPPPPPPPLPDPTPP 43 Score = 21.8 bits (44), Expect(2) = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 23 VPPPPPPPP 31 >AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase kappa protein. Length = 1271 Score = 28.7 bits (61), Expect(2) = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 24 PEPPPPWPPPPPPPAPPPAPP 44 Score = 22.2 bits (45), Expect(2) = 3.1 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A G PP G PPPP P Sbjct: 8 AQGTAPPQDGEQPAESPEPPPPWP 31 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 32.3 bits (70), Expect = 3.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PPP PP Sbjct: 584 PPPPPPPVSAGMMYAPPPPPP 604 Score = 27.9 bits (59), Expect(2) = 4.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 587 PPPPVSAGMMYAPPPPPPPP 606 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 600 PPPPPPPMDP 609 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 181 PPPPPPPLPPPPPPQPPPPPP 201 Score = 31.1 bits (67), Expect = 7.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 178 PPPPPPPPPP----LPPPPPP 194 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 181 PPPPPPPLPPPPPPQPPPPPP 201 Score = 31.1 bits (67), Expect = 7.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 178 PPPPPPPPPP----LPPPPPP 194 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 122 PPPPPPPLPPPPPPQPPPPPP 142 Score = 31.1 bits (67), Expect = 7.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 119 PPPPPPPPPP----LPPPPPP 135 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 627 PLPPPPPPPPPPPPPPPPPPP 647 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPP 2015 Score = 25.8 bits (54), Expect(2) = 8.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P PP Sbjct: 2004 PPPPPPPPPPPPPSAPP 2020 Score = 23.4 bits (48), Expect(2) = 8.1 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPP 2012 >AL157405-2|CAI19766.1| 73|Homo sapiens small proline-rich protein 2G protein. Length = 73 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P P PPPK P +LPPP PP Sbjct: 24 PEPCPPPKCP-EPYLPPPCPP 43 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 181 PPPPPPPLPPPPPPQPPPPPP 201 Score = 31.1 bits (67), Expect = 7.5 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 178 PPPPPPPPPP----LPPPPPP 194 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 331 PPPPPPPLPPPSSAGPPPPPP 351 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 627 PLPPPPPPPPPPPPPPPPPPP 647 >AF333957-1|AAK70944.1| 73|Homo sapiens small proline-rich protein 2G protein. Length = 73 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P P PPPK P +LPPP PP Sbjct: 24 PEPCPPPKCP-EPYLPPPCPP 43 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 32.3 bits (70), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 613 PLPPPPPPPPPPPPPPPPPPP 633 >AB048287-1|BAB40642.1| 73|Homo sapiens small proline rich protein like protein protein. Length = 73 Score = 32.3 bits (70), Expect = 3.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P P PPPK P +LPPP PP Sbjct: 24 PEPCPPPKCP-EPYLPPPCPP 43 >AL390961-5|CAI17276.1| 481|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 481 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 369 PPPPPPDDIPMFDDSPPPPPP 389 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 368 PPPPPP 373 >AL139404-5|CAH73113.1| 481|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 481 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 369 PPPPPPDDIPMFDDSPPPPPP 389 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 368 PPPPPP 373 >AL390961-1|CAI17277.1| 480|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 480 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 368 PPPPPPDDIPMFDDSPPPPPP 388 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 367 PPPPPP 372 >AL139404-1|CAH73114.1| 480|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 480 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 368 PPPPPPDDIPMFDDSPPPPPP 388 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 367 PPPPPP 372 >AF006516-1|AAB62569.1| 480|Homo sapiens e3B1 protein. Length = 480 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 368 PPPPPPDDIPMFDDSPPPPPP 388 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 367 PPPPPP 372 >BC024254-1|AAH24254.1| 476|Homo sapiens abl-interactor 1 protein. Length = 476 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 364 PPPPPPDDIPMFDDSPPPPPP 384 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 363 PPPPPP 368 >AL390961-4|CAI17274.1| 476|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 476 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 364 PPPPPPDDIPMFDDSPPPPPP 384 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 363 PPPPPP 368 >AL390961-2|CAI17273.1| 475|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 475 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 363 PPPPPPDDIPMFDDSPPPPPP 383 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 362 PPPPPP 367 >AL139404-4|CAH73115.1| 476|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 476 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 364 PPPPPPDDIPMFDDSPPPPPP 384 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 363 PPPPPP 368 >AL139404-2|CAH73119.1| 475|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 475 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 363 PPPPPPDDIPMFDDSPPPPPP 383 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 362 PPPPPP 367 >AB209268-1|BAD92505.1| 476|Homo sapiens Abl-interactor 1 variant protein. Length = 476 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 364 PPPPPPDDIPMFDDSPPPPPP 384 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 363 PPPPPP 368 >AL390961-8|CAI17279.1| 451|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 451 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 339 PPPPPPDDIPMFDDSPPPPPP 359 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 338 PPPPPP 343 >AL390961-6|CAI17278.1| 452|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 452 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 340 PPPPPPDDIPMFDDSPPPPPP 360 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 339 PPPPPP 344 >AL139404-8|CAH73117.1| 451|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 451 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 339 PPPPPPDDIPMFDDSPPPPPP 359 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 338 PPPPPP 343 >AL139404-6|CAH73116.1| 452|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 452 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 340 PPPPPPDDIPMFDDSPPPPPP 360 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 339 PPPPPP 344 >AF001628-1|AAD00897.1| 451|Homo sapiens interactor protein AblBP4 protein. Length = 451 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 339 PPPPPPDDIPMFDDSPPPPPP 359 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 338 PPPPPP 343 >AB040151-1|BAB55675.1| 452|Homo sapiens hNap1 Binding Protein protein. Length = 452 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 340 PPPPPPDDIPMFDDSPPPPPP 360 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 339 PPPPPP 344 >AL390961-3|CAI17272.1| 446|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 446 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 334 PPPPPPDDIPMFDDSPPPPPP 354 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 333 PPPPPP 338 >AL139404-3|CAH73118.1| 446|Homo sapiens spectrin SH3 domain binding protein 1 protein. Length = 446 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 334 PPPPPPDDIPMFDDSPPPPPP 354 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 333 PPPPPP 338 >AF260262-1|AAF70309.1| 446|Homo sapiens Abl-interactor protein 1 long protein. Length = 446 Score = 29.9 bits (64), Expect(2) = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 334 PPPPPPDDIPMFDDSPPPPPP 354 Score = 21.0 bits (42), Expect(2) = 3.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 333 PPPPPP 338 >AB067470-1|BAB67776.1| 1480|Homo sapiens KIAA1883 protein protein. Length = 1480 Score = 25.8 bits (54), Expect(2) = 4.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP+ P P P Sbjct: 774 PPPPPPPRAPADPAASPDPP 793 Score = 24.6 bits (51), Expect(2) = 4.0 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 P G G PPPPPP Sbjct: 762 PQYPGRGPPPAPPPPPPPP 780 >AB084087-1|BAC67014.1| 1422|Homo sapiens Formactin2 protein. Length = 1422 Score = 31.5 bits (68), Expect = 5.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 827 PGPPPPP-PPTFLGLPPPPPP 846 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 841 PPPPPPPLLDSIPPPPVP 858 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPP 820 + A G PPP + PPPPPP Sbjct: 824 REAPGPPPPPPPT---FLGLPPPPPP 846 >AB051482-1|BAB21786.1| 1199|Homo sapiens KIAA1695 protein protein. Length = 1199 Score = 31.5 bits (68), Expect = 5.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P LPPP PP Sbjct: 604 PGPPPPP-PPTFLGLPPPPPP 623 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPP 973 PPPP P +PPP P Sbjct: 618 PPPPPPPLLDSIPPPPVP 635 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 743 KXAXGXPPPXXGXGGXXVXXPPPPPP 820 + A G PPP + PPPPPP Sbjct: 601 REAPGPPPPPPPT---FLGLPPPPPP 623 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP+ P PPP PP G Sbjct: 50 PPPPPPPESPPPP--PPPPPPAEDG 72 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 31.9 bits (69), Expect = 4.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP+ P PPP PP G Sbjct: 256 PPPPPPPESPPPP--PPPPPPAEDG 278 >BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. Length = 360 Score = 28.7 bits (61), Expect(2) = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LPPP PP Sbjct: 185 PPPPPPPP----LPPPPPP 199 Score = 21.8 bits (44), Expect(2) = 4.4 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 174 PPTLPQPASHFPPPPPPPP 192 >AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens cDNA FLJ11029 fis, clone PLACE1004156. ). Length = 360 Score = 28.7 bits (61), Expect(2) = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LPPP PP Sbjct: 185 PPPPPPPP----LPPPPPP 199 Score = 21.8 bits (44), Expect(2) = 4.4 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 174 PPTLPQPASHFPPPPPPPP 192 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 29.5 bits (63), Expect(2) = 4.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 45 PPPPPP 50 >AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens cDNA FLJ20289 fis, clone HEP04492. ). Length = 210 Score = 28.7 bits (61), Expect(2) = 4.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P LPPP PP Sbjct: 35 PPPPPPPP----LPPPPPP 49 Score = 21.8 bits (44), Expect(2) = 4.6 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 24 PPTLPQPASHFPPPPPPPP 42 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 29.5 bits (63), Expect(2) = 4.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 47 PPPPPPPLPPPPP--PPPLPP 65 Score = 21.0 bits (42), Expect(2) = 4.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 46 PPPPPP 51 >AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 28.7 bits (61), Expect(2) = 5.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P +P P P Sbjct: 1444 PPPPPPPPPPPPPVIPHPAAP 1464 Score = 21.4 bits (43), Expect(2) = 5.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 + PPPPPP Sbjct: 1440 ILPPPPPPP 1448 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,245,428 Number of Sequences: 237096 Number of extensions: 3794587 Number of successful extensions: 42452 Number of sequences better than 10.0: 344 Number of HSP's better than 10.0 without gapping: 6551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30665 length of database: 76,859,062 effective HSP length: 91 effective length of database: 55,283,326 effective search space used: 15202914650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -