BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H10 (1102 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 31 0.014 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 31 0.014 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 38 0.024 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 38 0.024 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 38 0.024 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 38 0.024 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 38 0.024 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 31 0.040 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 31 0.040 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 31 0.040 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 31 0.040 AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p pro... 35 0.051 AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-P... 35 0.051 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 36 0.075 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 33 0.088 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 28 0.090 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 34 0.099 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 34 0.099 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 31 0.15 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 31 0.15 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 30 0.15 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 35 0.17 J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.me... 35 0.17 DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 prot... 35 0.17 DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 prot... 35 0.17 BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p pro... 35 0.17 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 35 0.17 BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p pro... 35 0.17 AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-P... 35 0.17 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 35 0.17 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 35 0.17 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 32 0.20 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 35 0.23 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 35 0.23 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 35 0.23 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 35 0.23 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 35 0.23 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 35 0.23 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 35 0.23 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 35 0.23 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 35 0.23 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 35 0.23 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 35 0.23 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 34 0.40 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 34 0.40 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 34 0.40 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 31 0.40 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 31 0.40 AE014297-1700|AAN13569.1| 112|Drosophila melanogaster CG9759-PB... 33 0.53 AE014297-1699|AAF54958.1| 112|Drosophila melanogaster CG9759-PA... 33 0.53 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 27 0.73 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 27 0.79 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 27 1.2 AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p pro... 27 1.2 AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB... 27 1.2 AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA... 27 1.2 AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC... 27 1.2 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 27 1.2 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 27 1.2 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 27 1.5 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 27 2.0 BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p pro... 28 2.0 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 31 2.1 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 31 2.1 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 31 2.1 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 31 2.1 AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-P... 26 2.6 AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-P... 26 2.6 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 27 2.7 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 31 2.8 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 31 2.8 BT030423-1|ABO52843.1| 506|Drosophila melanogaster IP17710p pro... 31 2.8 BT023765-1|AAZ41773.1| 701|Drosophila melanogaster RE18252p pro... 31 2.8 AE014298-1912|AAF48279.1| 458|Drosophila melanogaster CG15753-P... 31 2.8 AE014134-2732|AAN10947.1| 701|Drosophila melanogaster CG5953-PB... 31 2.8 AE014134-2731|AAF53541.2| 701|Drosophila melanogaster CG5953-PA... 31 2.8 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 27 3.5 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 27 3.5 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 27 3.5 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 31 3.7 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 31 3.7 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 31 3.7 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 31 3.7 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 31 3.7 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 31 3.7 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 31 3.7 AY113393-1|AAM29398.1| 891|Drosophila melanogaster RE07247p pro... 31 3.7 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 31 3.7 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 31 3.7 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 31 3.7 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 31 3.7 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 31 3.7 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 31 3.7 AE014296-2707|AAF49484.2| 891|Drosophila melanogaster CG4998-PA... 31 3.7 AE014296-2706|ABI31256.1| 1185|Drosophila melanogaster CG4998-PB... 31 3.7 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 31 3.7 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 31 3.7 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 30 4.9 BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p pro... 30 4.9 BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p pro... 30 4.9 AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-P... 30 4.9 AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-P... 30 4.9 AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-P... 30 4.9 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 30 4.9 AE013599-1228|AAF58703.1| 120|Drosophila melanogaster CG13227-P... 30 4.9 U29608-1|AAA70336.1| 1099|Drosophila melanogaster LATS protein. 30 6.5 L39837-1|AAA73959.1| 1099|Drosophila melanogaster tumor suppress... 30 6.5 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 30 6.5 BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p pro... 30 6.5 BT004830-1|AAO45186.1| 821|Drosophila melanogaster SD19495p pro... 30 6.5 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 30 6.5 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 30 6.5 AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-P... 30 6.5 AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-P... 30 6.5 AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-P... 30 6.5 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 30 6.5 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 30 6.5 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 30 6.5 AJ223300-1|CAA11241.1| 902|Drosophila melanogaster homebox prot... 27 7.3 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 27 7.7 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 27 7.7 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 27 7.7 AY051667-1|AAK93091.1| 400|Drosophila melanogaster LD21709p pro... 25 7.8 AE014134-3575|AAN11147.1| 400|Drosophila melanogaster CG15218-P... 25 7.8 AE014134-3574|AAN11146.1| 400|Drosophila melanogaster CG15218-P... 25 7.8 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 27 8.3 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 29 8.6 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 29 8.6 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 29 8.6 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 29 8.6 AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p pro... 25 9.4 AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB... 25 9.4 BT003217-1|AAO24972.1| 824|Drosophila melanogaster RE10170p pro... 26 9.5 AE013599-1059|AAM68778.1| 824|Drosophila melanogaster CG18408-P... 26 9.5 AB053480-1|BAB62019.1| 824|Drosophila melanogaster DCAPL3 protein. 26 9.5 AE013599-1060|AAF58815.2| 811|Drosophila melanogaster CG18408-P... 26 9.6 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 31.1 bits (67), Expect(2) = 0.014 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P P PP Sbjct: 242 PPPPPPPPPPSYPYPPYPYPP 262 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 + P PPPPP P PP PP G Sbjct: 54 YYPPPPPPPPPPPQHCNCPPGPPGPPG 80 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 152 PAPPPPPPPPPPP--PPPPPP 170 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 154 PPPPPPPPPPPP---PPPPPP 171 Score = 29.5 bits (63), Expect(2) = 0.11 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + PP P G Sbjct: 245 PPPPPPPSYPYPPYPYPPPGPYPG 268 Score = 28.3 bits (60), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P + PP P Sbjct: 240 PPPPPPPPPPPPSYPYPPYP 259 Score = 26.6 bits (56), Expect(2) = 0.014 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPPPP Sbjct: 225 PPGPPGPPGTTYPQPPPPPP 244 Score = 25.0 bits (52), Expect(2) = 0.11 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P P G PPPPPP Sbjct: 224 GPPGPPGPPGTTYPQPPPPPPP 245 Score = 22.6 bits (46), Expect(2) = 1.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 228 PPGPPGTTYPQPPPPPPPPP 247 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 31.1 bits (67), Expect(2) = 0.014 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P + P P PP Sbjct: 240 PPPPPPPPPPSYPYPPYPYPP 260 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPPXXGG 985 + P PPPPP P PP PP G Sbjct: 52 YYPPPPPPPPPPPQHCNCPPGPPGPPG 78 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 150 PAPPPPPPPPPPP--PPPPPP 168 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 152 PPPPPPPPPPPP---PPPPPP 169 Score = 29.5 bits (63), Expect(2) = 0.12 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + PP P G Sbjct: 243 PPPPPPPSYPYPPYPYPPPGPYPG 266 Score = 28.3 bits (60), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P + PP P Sbjct: 238 PPPPPPPPPPPPSYPYPPYP 257 Score = 26.6 bits (56), Expect(2) = 0.014 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G G PPPPPP Sbjct: 223 PPGPPGPPGTTYPQPPPPPP 242 Score = 25.0 bits (52), Expect(2) = 0.12 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G P P G PPPPPP Sbjct: 222 GPPGPPGPPGTTYPQPPPPPPP 243 Score = 22.6 bits (46), Expect(2) = 1.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP G PPPPPP Sbjct: 226 PPGPPGTTYPQPPPPPPPPP 245 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 37.9 bits (84), Expect = 0.024 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 534 Query: 983 GG 988 GG Sbjct: 535 GG 536 Score = 35.5 bits (78), Expect = 0.13 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--- 973 PPPPPP F + PPPPP P PPP PP Sbjct: 477 PPPPPPPLHAFV----APPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 532 Query: 974 XXGGG 988 GGG Sbjct: 533 EGGGG 537 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 508 GAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 37.9 bits (84), Expect = 0.024 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 544 Query: 983 GG 988 GG Sbjct: 545 GG 546 Score = 35.5 bits (78), Expect = 0.13 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--- 973 PPPPPP F + PPPPP P PPP PP Sbjct: 487 PPPPPPPLHAFV----APPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 542 Query: 974 XXGGG 988 GGG Sbjct: 543 EGGGG 547 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 518 GAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 37.9 bits (84), Expect = 0.024 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 534 Query: 983 GG 988 GG Sbjct: 535 GG 536 Score = 35.5 bits (78), Expect = 0.13 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--- 973 PPPPPP F + PPPPP P PPP PP Sbjct: 477 PPPPPPPLHAFV----APPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 532 Query: 974 XXGGG 988 GGG Sbjct: 533 EGGGG 537 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 508 GAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 37.9 bits (84), Expect = 0.024 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 692 Query: 983 GG 988 GG Sbjct: 693 GG 694 Score = 35.5 bits (78), Expect = 0.13 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--- 973 PPPPPP F + PPPPP P PPP PP Sbjct: 635 PPPPPPPLHAFV----APPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 690 Query: 974 XXGGG 988 GGG Sbjct: 691 EGGGG 695 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 666 GAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 37.9 bits (84), Expect = 0.024 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEG 639 Query: 983 GG 988 GG Sbjct: 640 GG 641 Score = 35.5 bits (78), Expect = 0.13 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--- 973 PPPPPP F + PPPPP P PPP PP Sbjct: 582 PPPPPPPLHAFV----APPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 637 Query: 974 XXGGG 988 GGG Sbjct: 638 EGGGG 642 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 613 GAPPPPPPPPPGSGSAPPPPPP 634 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 31.5 bits (68), Expect(2) = 0.040 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP G Sbjct: 382 PPPPPPPPPAAVPPPPPPPMPVG 404 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 383 PPPPPPPPAA----VPPPPPP 399 Score = 24.6 bits (51), Expect(2) = 0.040 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPP 389 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPP 390 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 31.5 bits (68), Expect(2) = 0.040 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP G Sbjct: 382 PPPPPPPPPAAVPPPPPPPMPVG 404 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 383 PPPPPPPPAA----VPPPPPP 399 Score = 24.6 bits (51), Expect(2) = 0.040 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPP 389 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPP 390 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 31.5 bits (68), Expect(2) = 0.040 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP G Sbjct: 382 PPPPPPPPPAAVPPPPPPPMPVG 404 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 383 PPPPPPPPAA----VPPPPPP 399 Score = 24.6 bits (51), Expect(2) = 0.040 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 370 PPPPPVSAPVVAPPPPPPPP 389 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 371 PPPPVSAPVVAPPPPPPPPP 390 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 31.5 bits (68), Expect(2) = 0.040 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP G Sbjct: 349 PPPPPPPPPAAVPPPPPPPMPVG 371 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP +PPP PP Sbjct: 350 PPPPPPPPAA----VPPPPPP 366 Score = 24.6 bits (51), Expect(2) = 0.040 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 337 PPPPPVSAPVVAPPPPPPPP 356 Score = 23.8 bits (49), Expect(2) = 1.6 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 338 PPPPVSAPVVAPPPPPPPPP 357 >AY118390-1|AAM48419.1| 873|Drosophila melanogaster RE39020p protein. Length = 873 Score = 35.1 bits (77), Expect(2) = 0.051 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PPP G GG PPPPPP Sbjct: 669 GPPPPHVGHGGHGQPQPPPPPP 690 Score = 20.6 bits (41), Expect(2) = 0.051 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 911 PXPPPPP 931 P PPPPP Sbjct: 685 PPPPPPP 691 >AE013599-3085|AAF46639.3| 873|Drosophila melanogaster CG10052-PA protein. Length = 873 Score = 35.1 bits (77), Expect(2) = 0.051 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PPP G GG PPPPPP Sbjct: 669 GPPPPHVGHGGHGQPQPPPPPP 690 Score = 20.6 bits (41), Expect(2) = 0.051 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 911 PXPPPPP 931 P PPPPP Sbjct: 685 PPPPPPP 691 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 36.3 bits (80), Expect = 0.075 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 905 FXPXPPPPPKXPXXXFLPPPXPP 973 + P PPPPP P + PPP PP Sbjct: 185 YPPPPPPPPYYPPYPYYPPPPPP 207 Score = 30.7 bits (66), Expect = 3.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P + PPP PP Sbjct: 188 PPPPPPYYPPYPYYPPPPPPP 208 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 33.1 bits (72), Expect(2) = 0.088 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 467 PPPPPPPPPPPPPTEPPPPPP 487 Score = 32.7 bits (71), Expect = 0.92 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 468 PPPPPPPPPPPPTEPPPPPPP 488 Score = 32.3 bits (70), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 469 PPPPPPPPPPPTEPPPPPPPP 489 Score = 32.3 bits (70), Expect = 1.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 470 PPPPPPPPPPTEPPPPPPPPP 490 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP PP Sbjct: 466 PPPPPPPPPPPPPPTEPPPPP 486 Score = 29.5 bits (63), Expect = 8.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 473 PPPPPPPTEPPPPPPPPPEP 492 Score = 21.8 bits (44), Expect(2) = 0.088 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 794 VXXPPPPPP 820 V PPPPPP Sbjct: 460 VHHPPPPPP 468 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 28.3 bits (60), Expect(2) = 0.090 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 713 FFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 F F KK + PPP PPPPPP Sbjct: 199 FLFKVLAKKVELLCPRPPPFYKPSRPNRRPPPPPPP 234 Score = 26.6 bits (56), Expect(2) = 0.090 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P L P P Sbjct: 230 PPPPPPPPPPPPPTLSPSLP 249 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 33.9 bits (74), Expect = 0.40 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P ++PPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAP 63 Score = 30.7 bits (66), Expect(2) = 0.099 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P ++PP P Sbjct: 70 PPPPPPPPAPKNTYIPPAPAP 90 Score = 24.2 bits (50), Expect(2) = 0.099 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 58 PPPAAPAKAYIPPPPPPPPP 77 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 33.9 bits (74), Expect = 0.40 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P ++PPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAP 63 Score = 30.7 bits (66), Expect(2) = 0.099 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P ++PP P Sbjct: 70 PPPPPPPPAPKNTYIPPAPAP 90 Score = 24.2 bits (50), Expect(2) = 0.099 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 58 PPPAAPAKAYIPPPPPPPPP 77 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 31.1 bits (67), Expect = 2.8 Identities = 18/76 (23%), Positives = 21/76 (27%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP + PPPP P + P P P P Sbjct: 157 PPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVG 216 Query: 941 XXXFLPPPXPPXXGGG 988 +P P PP GG Sbjct: 217 GVMVMPSPTPPPPAGG 232 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPP PPP PP GG Sbjct: 224 PTPPPPAGGVLVMPRPPPPPPPAGG 248 Score = 28.7 bits (61), Expect(2) = 0.15 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PP PP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 25.8 bits (54), Expect(2) = 2.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP G + PPPPP Sbjct: 239 PPPPPPPAGGVLVMPPPPP 257 Score = 25.4 bits (53), Expect(2) = 0.15 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P GG V PPPPP Sbjct: 224 PTPPPPAGGVLVMPRPPPPP 243 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPP 964 PPPPP PPP Sbjct: 253 PPPPPSFTPAEVAPPP 268 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 31.1 bits (67), Expect = 2.8 Identities = 18/76 (23%), Positives = 21/76 (27%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP + PPPP P + P P P P Sbjct: 157 PPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVG 216 Query: 941 XXXFLPPPXPPXXGGG 988 +P P PP GG Sbjct: 217 GVMVMPSPTPPPPAGG 232 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPP PPP PP GG Sbjct: 224 PTPPPPAGGVLVMPRPPPPPPPAGG 248 Score = 28.7 bits (61), Expect(2) = 0.15 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP + PP PP Sbjct: 237 PRPPPPPPPAGGVLVMPPPPP 257 Score = 25.8 bits (54), Expect(2) = 2.7 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP G + PPPPP Sbjct: 239 PPPPPPPAGGVLVMPPPPP 257 Score = 25.4 bits (53), Expect(2) = 0.15 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P GG V PPPPP Sbjct: 224 PTPPPPAGGVLVMPRPPPPP 243 Score = 23.8 bits (49), Expect(2) = 2.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPP 964 PPPPP PPP Sbjct: 253 PPPPPSFTPAEVAPPP 268 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 30.3 bits (65), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP + PPP PP Sbjct: 167 PPPPPPTKKVVYTPPPPPP 185 Score = 30.3 bits (65), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP + PPP PP Sbjct: 180 PPPPPPTKKVVYTPPPPPP 198 Score = 30.3 bits (65), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP + PPP PP Sbjct: 193 PPPPPPTKKVVYTPPPPPP 211 Score = 30.3 bits (65), Expect = 4.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP + PPP PP Sbjct: 280 PPPPPPTKKVVYTPPPPPP 298 Score = 30.3 bits (65), Expect(2) = 0.15 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP + PPP PP Sbjct: 293 PPPPPPTKKVVYTPPPPPP 311 Score = 26.6 bits (56), Expect(2) = 4.6 Identities = 11/24 (45%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Frame = +2 Query: 911 PXPP---PPPKXPXXXFLPPPXPP 973 P PP PPP + PPP PP Sbjct: 384 PPPPVYIPPPTKKVVVYTPPPPPP 407 Score = 23.8 bits (49), Expect(2) = 0.15 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 710 PFFFXKXKKKXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 P + KK PPP V PPPPPP Sbjct: 266 PVYVPPPTKKVIYTPPPPPPTK----KVVYTPPPPPP 298 Score = 22.2 bits (45), Expect(2) = 4.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 794 VXXPPPPPPXFF 829 V PPPPPP + Sbjct: 378 VYTPPPPPPPVY 389 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMG 564 Score = 34.3 bits (75), Expect = 0.30 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PPP P GG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPP 541 Score = 33.1 bits (72), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PP P GGG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPPP 542 Score = 31.9 bits (69), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 812 GGGXKXPXPPPPPXXGGGXPXP 747 GGG P PPP P GG P P Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPP 557 Score = 31.9 bits (69), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPP 546 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 512 PMPPPPPGGGGAPPPP 527 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 G GG P PPPPP GG P P Sbjct: 549 GRAGGP--PPPPPPPGMGGPPPPP 570 >J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.melanogaster forkhead protein (fkh) gene, complete cds. ). Length = 510 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 protein. Length = 53 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p protein. Length = 510 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMG 564 Score = 34.3 bits (75), Expect = 0.30 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PPP P GG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPP 541 Score = 33.1 bits (72), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PP P GGG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPPP 542 Score = 31.9 bits (69), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 812 GGGXKXPXPPPPPXXGGGXPXP 747 GGG P PPP P GG P P Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPP 557 Score = 31.9 bits (69), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPP 546 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 512 PMPPPPPGGGGAPPPP 527 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 G GG P PPPPP GG P P Sbjct: 549 GRAGGP--PPPPPPPGMGGPPPPP 570 >BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p protein. Length = 426 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-PA protein. Length = 510 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPP 819 G G PP GGGGG G PPPP Sbjct: 21 GGGGPPSGGGGGGGGGGGGGPPPP 44 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMG 564 Score = 34.3 bits (75), Expect = 0.30 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PPP P GG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPP 541 Score = 33.1 bits (72), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PP P GGG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPPP 542 Score = 31.9 bits (69), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 812 GGGXKXPXPPPPPXXGGGXPXP 747 GGG P PPP P GG P P Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPP 557 Score = 31.9 bits (69), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPP 546 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 512 PMPPPPPGGGGAPPPP 527 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 G GG P PPPPP GG P P Sbjct: 549 GRAGGP--PPPPPPPGMGGPPPPP 570 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 35.1 bits (77), Expect = 0.17 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP P PPP PP G G Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMG 564 Score = 34.3 bits (75), Expect = 0.30 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 815 GGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PPP P GG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPP 541 Score = 33.1 bits (72), Expect = 0.70 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 GGGG P PP P GGG P P Sbjct: 519 GGGGAPPPPPPPMPGRAGGGPPPP 542 Score = 31.9 bits (69), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 812 GGGXKXPXPPPPPXXGGGXPXP 747 GGG P PPP P GG P P Sbjct: 536 GGGPPPPPPPPMPGRAGGPPPP 557 Score = 31.9 bits (69), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPPP PPP PP GG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 750 PGXPPPPXXGXGGXXSFXPPPPP 818 P PPPP G G PPPPP Sbjct: 524 PPPPPPPMPGRAGGGPPPPPPPP 546 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 794 PXPPPPPXXGGGXPXP 747 P PPPPP GG P P Sbjct: 512 PMPPPPPGGGGAPPPP 527 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 818 GGGGGXKXPXPPPPPXXGGGXPXP 747 G GG P PPPPP GG P P Sbjct: 549 GRAGGP--PPPPPPPGMGGPPPPP 570 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 32.3 bits (70), Expect(2) = 0.20 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PPP PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGG 985 PPPPP P PPP PP G Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPG 95 Score = 21.4 bits (43), Expect(2) = 0.20 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 P G + PPPPPP Sbjct: 62 PRHVGKPKAKLPPPPPPPP 80 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 34.7 bits (76), Expect = 0.23 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--X 976 PPPPPP F + PPPPP P PPP PP Sbjct: 487 PPPPPPPLPAFV-----APPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPI 541 Query: 977 XGGG 988 GGG Sbjct: 542 EGGG 545 Score = 34.3 bits (75), Expect = 0.30 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 544 Query: 983 GG 988 GG Sbjct: 545 GG 546 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 517 GAPPPPPPPPPGSGSAPPPPPP 538 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 406 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 462 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 463 APGGPGAP-PPPPPPPGLGG 481 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 459 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 460 PPPAPGGPG 468 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 427 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 443 GGGPPPAPPAPPAMGGGPP 461 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 34.7 bits (76), Expect = 0.23 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--X 976 PPPPPP F + PPPPP P PPP PP Sbjct: 582 PPPPPPPLPAFV-----APPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPI 636 Query: 977 XGGG 988 GGG Sbjct: 637 EGGG 640 Score = 34.3 bits (75), Expect = 0.30 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 639 Query: 983 GG 988 GG Sbjct: 640 GG 641 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 612 GAPPPPPPPPPGSGSAPPPPPP 633 Score = 29.9 bits (64), Expect = 6.5 Identities = 21/81 (25%), Positives = 23/81 (28%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFX 910 +K A PPP PPPPPP Sbjct: 573 EKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPP-----PPPMANYGAPPPPPPPPPGSGSA 627 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP +PPP PP Sbjct: 628 PPPPPPAPIEGGGGIPPPPPP 648 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 34.7 bits (76), Expect = 0.23 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPP--X 976 PPPPPP F + PPPPP P PPP PP Sbjct: 715 PPPPPPPLPAFV-----APPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPI 769 Query: 977 XGGG 988 GGG Sbjct: 770 EGGG 773 Score = 34.3 bits (75), Expect = 0.30 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 803 PPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFLPPPXPPXXG 982 PPPPPP F+ P PPPPP PPP P G Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 772 Query: 983 GG 988 GG Sbjct: 773 GG 774 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PPPP G S PPPPP Sbjct: 745 GAPPPPPPPPPGSGSAPPPPPP 766 Score = 29.9 bits (64), Expect = 6.5 Identities = 21/81 (25%), Positives = 23/81 (28%) Frame = +2 Query: 731 KKKXKXAXGXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFX 910 +K A PPP PPPPPP Sbjct: 706 EKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPP-----PPPMANYGAPPPPPPPPPGSGSA 760 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP +PPP PP Sbjct: 761 PPPPPPAPIEGGGGIPPPPPP 781 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 409 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 465 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 466 APGGPGAP-PPPPPPPGLGG 484 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 462 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 463 PPPAPGGPG 471 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 430 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 446 GGGPPPAPPAPPAMGGGPP 464 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 552 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 608 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 609 APGGPGAP-PPPPPPPGLGG 627 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 546 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 605 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 606 PPPAPGGPG 614 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 545 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 573 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 589 GGGPPPAPPAPPAMGGGPP 607 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 551 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 607 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 608 APGGPGAP-PPPPPPPGLGG 626 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 545 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 604 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 605 PPPAPGGPG 613 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 572 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 588 GGGPPPAPPAPPAMGGGPP 606 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 406 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 462 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 463 APGGPGAP-PPPPPPPGLGG 481 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 459 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 460 PPPAPGGPG 468 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 427 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 443 GGGPPPAPPAPPAMGGGPP 461 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 406 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 462 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 463 APGGPGAP-PPPPPPPGLGG 481 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 459 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 460 PPPAPGGPG 468 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 427 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 443 GGGPPPAPPAPPAMGGGPP 461 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 406 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 462 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 463 APGGPGAP-PPPPPPPGLGG 481 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 400 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 459 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 460 PPPAPGGPG 468 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 399 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 427 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 443 GGGPPPAPPAPPAMGGGPP 461 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 34.7 bits (76), Expect = 0.23 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPP-PPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPP 925 A PPP GG PPPP PP F PPP Sbjct: 409 APAPPPPPPSFGGAAGGGPPPPAPPQMFNG---APPPPAMGGGPPPAPPAPPAMGGGPPP 465 Query: 926 PPKXPXXXFLPPPXPPXXGG 985 P P PPP PP GG Sbjct: 466 APGGPGAP-PPPPPPPGLGG 484 Score = 32.3 bits (70), Expect = 1.2 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 776 GXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXPXXXFL 955 G GG PPPPPP F PP PP P Sbjct: 403 GPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG 462 Query: 956 PPPXPPXXG 982 PPP P G Sbjct: 463 PPPAPGGPG 471 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP-----XXGGGXPXP 747 GG GG P PPPPP GGG P P Sbjct: 402 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP 430 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 809 GGXKXPXPPPPPXXGGGXP 753 GG P PP PP GGG P Sbjct: 446 GGGPPPAPPAPPAMGGGPP 464 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 33.9 bits (74), Expect = 0.40 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPPPPP PPPPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPA----PTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPP 227 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 228 KVELPPPPAPP 238 Score = 29.9 bits (64), Expect = 6.5 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPP PP PPPPP P Sbjct: 94 PPPPPRPASPKVEPPPPAPPG-------VESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 146 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 147 TLVPPPPPAPP 157 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 150 PPPPPAPPTIKPPPPPAPP 168 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 33.9 bits (74), Expect = 0.40 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPPPPP PPPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPA----PTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPP 490 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 491 KVELPPPPAPP 501 Score = 29.9 bits (64), Expect = 6.5 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPP PP PPPPP P Sbjct: 357 PPPPPRPASPKVEPPPPAPPG-------VESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 410 TLVPPPPPAPP 420 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 413 PPPPPAPPTIKPPPPPAPP 431 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 33.9 bits (74), Expect = 0.40 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPPPPP PPPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPA----PTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPP 490 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 491 KVELPPPPAPP 501 Score = 29.9 bits (64), Expect = 6.5 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPKXP 940 PPP V PPP PP PPPPP P Sbjct: 357 PPPPPRPASPKVEPPPPAPPG-------VESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 941 XXXFLPPPXPP 973 PPP PP Sbjct: 410 TLVPPPPPAPP 420 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPP 973 PPPPP P PPP PP Sbjct: 413 PPPPPAPPTIKPPPPPAPP 431 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 31.1 bits (67), Expect = 2.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP G Sbjct: 271 PPPPPPPMAPAA---PPPPPPPING 292 Score = 30.7 bits (66), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 280 PAAPPPPPPPINGAAPPPPPP 300 Score = 30.7 bits (66), Expect(2) = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGG 306 Score = 30.3 bits (65), Expect(2) = 0.40 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 295 PPPPPPPMINGGALPPPPPPP 315 Score = 22.2 bits (45), Expect(2) = 0.40 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A PPP PPPPP Sbjct: 279 APAAPPPPPPPINGAAPPPPPPP 301 Score = 21.8 bits (44), Expect(2) = 0.40 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPP 289 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 31.1 bits (67), Expect = 2.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PPP PP G Sbjct: 271 PPPPPPPMAPAA---PPPPPPPING 292 Score = 30.7 bits (66), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPP P PPP PP Sbjct: 280 PAAPPPPPPPINGAAPPPPPP 300 Score = 30.7 bits (66), Expect(2) = 0.40 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP PPP PP GG Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGG 306 Score = 30.3 bits (65), Expect(2) = 0.40 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PPP PP Sbjct: 295 PPPPPPPMINGGALPPPPPPP 315 Score = 22.2 bits (45), Expect(2) = 0.40 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPP 817 A PPP PPPPP Sbjct: 279 APAAPPPPPPPINGAAPPPPPPP 301 Score = 21.8 bits (44), Expect(2) = 0.40 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPP 817 PPP PPPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPP 289 >AE014297-1700|AAN13569.1| 112|Drosophila melanogaster CG9759-PB, isoform B protein. Length = 112 Score = 33.5 bits (73), Expect = 0.53 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 778 GGGGXGXFXPPPPPXF 825 GGGG G F PPPPP F Sbjct: 91 GGGGFGGFYPPPPPFF 106 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPPXFFXFXFF 843 G G P GGGG G + PPPP FF F+ Sbjct: 82 GGGFRRPGFGGGGFGGFY--PPPPPFFGGPFY 111 >AE014297-1699|AAF54958.1| 112|Drosophila melanogaster CG9759-PA, isoform A protein. Length = 112 Score = 33.5 bits (73), Expect = 0.53 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 778 GGGGXGXFXPPPPPXF 825 GGGG G F PPPPP F Sbjct: 91 GGGGFGGFYPPPPPFF 106 Score = 31.9 bits (69), Expect = 1.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXFXPPPPPXFFXFXFF 843 G G P GGGG G + PPPP FF F+ Sbjct: 82 GGGFRRPGFGGGGFGGFY--PPPPPFFGGPFY 111 >AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA protein. Length = 575 Score = 27.1 bits (57), Expect(2) = 0.73 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P +PP Sbjct: 51 PPPPPPPFQPIGPLIPP 67 Score = 24.6 bits (51), Expect(2) = 0.73 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXF 826 PPP G PPPPPP F Sbjct: 41 PPPQ----GPPYPAPPPPPPPF 58 >BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p protein. Length = 195 Score = 27.1 bits (57), Expect(2) = 0.79 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPP 961 P PPPPP P +PP Sbjct: 51 PPPPPPPFQPIGPLIPP 67 Score = 24.6 bits (51), Expect(2) = 0.79 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPPXF 826 PPP G PPPPPP F Sbjct: 41 PPPQ----GPPYPAPPPPPPPF 58 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 27.1 bits (57), Expect(2) = 4.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P PPP PP G Sbjct: 511 PAPPPMPVFGAGGAPPPPPPPSSG 534 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP +PPP P Sbjct: 526 PPPPPPSSGMAGVPPPPP 543 Score = 25.0 bits (52), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P G GG PPPPPP Sbjct: 515 PMPVFGAGGAP---PPPPPP 531 Score = 21.8 bits (44), Expect(2) = 4.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G V PPP PP Sbjct: 489 PPPTAASVG--VPPPPPAPP 506 >AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p protein. Length = 607 Score = 27.5 bits (58), Expect(2) = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPP--XGGGG 989 PPPP G P PP GGGG Sbjct: 309 PPPPSESHGRIHGRPTTPPPVRGGGG 334 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PP G S PPPPP Sbjct: 291 GPRSPPPKPRGHYRSGAPPPPP 312 >AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB, isoform B protein. Length = 607 Score = 27.5 bits (58), Expect(2) = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPP--XGGGG 989 PPPP G P PP GGGG Sbjct: 309 PPPPSESHGRIHGRPTTPPPVRGGGG 334 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PP G S PPPPP Sbjct: 291 GPRSPPPKPRGHYRSGAPPPPP 312 >AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA, isoform A protein. Length = 607 Score = 27.5 bits (58), Expect(2) = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPP--XGGGG 989 PPPP G P PP GGGG Sbjct: 309 PPPPSESHGRIHGRPTTPPPVRGGGG 334 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PP G S PPPPP Sbjct: 291 GPRSPPPKPRGHYRSGAPPPPP 312 >AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC, isoform C protein. Length = 567 Score = 27.5 bits (58), Expect(2) = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +3 Query: 918 PPPPQXXRGXFFSXPPXPP--XGGGG 989 PPPP G P PP GGGG Sbjct: 269 PPPPSESHGRIHGRPTTPPPVRGGGG 294 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 753 GXPPPPXXGXGGXXSFXPPPPP 818 G PP G S PPPPP Sbjct: 251 GPRSPPPKPRGHYRSGAPPPPP 272 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 27.1 bits (57), Expect(2) = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P PPP PP G Sbjct: 395 PAPPPMPVFGAGGAPPPPPPPSSG 418 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP +PPP P Sbjct: 410 PPPPPPSSGMAGVPPPPP 427 Score = 25.0 bits (52), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P G GG PPPPPP Sbjct: 399 PMPVFGAGGAP---PPPPPP 415 Score = 21.8 bits (44), Expect(2) = 4.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G V PPP PP Sbjct: 373 PPPTAASVG--VPPPPPAPP 390 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 27.1 bits (57), Expect(2) = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPP P PPP PP G Sbjct: 395 PAPPPMPVFGAGGAPPPPPPPSSG 418 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP +PPP P Sbjct: 410 PPPPPPSSGMAGVPPPPP 427 Score = 25.0 bits (52), Expect(2) = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 P P G GG PPPPPP Sbjct: 399 PMPVFGAGGAP---PPPPPP 415 Score = 21.8 bits (44), Expect(2) = 4.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G V PPP PP Sbjct: 373 PPPTAASVG--VPPPPPAPP 390 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 27.1 bits (57), Expect(2) = 3.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P P PP PP Sbjct: 697 PPPPPMPASPTASSAAPPPPP 717 Score = 26.2 bits (55), Expect(2) = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P PPP P Sbjct: 713 PPPPPPPAPP----APPPPP 728 Score = 24.2 bits (50), Expect(2) = 1.5 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP PPPPPP Sbjct: 699 PPPMPASPTASSAAPPPPPP 718 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G + PPPPPP Sbjct: 689 GAASLTLPPPPPP 701 >AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA protein. Length = 1027 Score = 27.5 bits (58), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPP 964 PPPPP P + PPP Sbjct: 477 PPPPPPPPSPSYEPPP 492 Score = 25.8 bits (54), Expect(2) = 9.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP P PP P Sbjct: 477 PPPPPPPPSPSYEPPPPSYAP 497 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 749 AXGXPPPXXGXGGXXVXXPPPPPP 820 A PP PPPPPP Sbjct: 460 ALAPAPPARSPTPAAAAPPPPPPP 483 Score = 21.8 bits (44), Expect(2) = 9.4 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 465 PPARSPTPAAAAPPPPPPPP 484 >BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p protein. Length = 840 Score = 27.9 bits (59), Expect(2) = 2.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXGGG 988 PPPPP P PP GGG Sbjct: 587 PPPPPGGAYSTTAPSQTPPPQGGG 610 Score = 22.2 bits (45), Expect(2) = 2.0 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PP GG PPPP Sbjct: 569 GAPPGSSYPGGPPTSGAAPPPP 590 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 31.5 bits (68), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P +LPP P Sbjct: 208 PPPPPPPVAPKKLYLPPAEP 227 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P +LPP P Sbjct: 114 PPPPPPPPKATYLPPSKP 131 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPPPK-XPXXXFLPPPXPP 973 P PPPPP+ P + PPP PP Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPP 229 Score = 31.1 bits (67), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 911 PXPPPPPK-XPXXXFLPPPXPPXXG 982 P PPPPPK P + PP PP G Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPG 249 Score = 30.3 bits (65), Expect = 4.9 Identities = 21/79 (26%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G PP PP + P PP PP Sbjct: 300 GPPPPAPPAGPTYQPRPPAPPAP------APGPTYQPRPPAPPAPAPGPTYQPRPPSPPA 353 Query: 935 XPXXXFLP-PPXPPXXGGG 988 P + P PP PP G Sbjct: 354 PPAPTYQPQPPAPPAPAPG 372 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 31.5 bits (68), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP P +LPP P Sbjct: 208 PPPPPPPVAPKKLYLPPAEP 227 Score = 29.5 bits (63), Expect = 8.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXP 970 PPPPP P +LPP P Sbjct: 114 PPPPPPPPKATYLPPSKP 131 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 31.5 bits (68), Expect = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +2 Query: 911 PXPPPPPK-XPXXXFLPPPXPP 973 P PPPPP+ P + PPP PP Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPP 229 Score = 31.1 bits (67), Expect = 2.8 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 911 PXPPPPPK-XPXXXFLPPPXPPXXG 982 P PPPPPK P + PP PP G Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPG 249 Score = 30.3 bits (65), Expect = 4.9 Identities = 21/79 (26%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPPXFFXFXFLXXXXXXXXXXXXXXXXXXXXFXPXPPPPPK 934 G PPP G PP PP + P PP PP Sbjct: 300 GPPPPAPPAGPTYQPRPPAPPAP------APGPTYQPRPPAPPAPAPGPTYQPRPPSPPA 353 Query: 935 XPXXXFLP-PPXPPXXGGG 988 P + P PP PP G Sbjct: 354 PPAPTYQPQPPAPPAPAPG 372 >AE014298-2110|AAN09656.1| 968|Drosophila melanogaster CG15028-PB, isoform B protein. Length = 968 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 GG V PPPPPP Sbjct: 627 GGGAVPRPPPPPP 639 Score = 25.4 bits (53), Expect(2) = 7.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G GG PPPPPP Sbjct: 626 GGGGAVPRPPPPPPP 640 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP+ P Sbjct: 637 PPPPPPPRKP 646 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 632 PRPPPPPPPP 641 >AE014298-2111|AAF48430.1| 858|Drosophila melanogaster CG15028-PA, isoform A protein. Length = 858 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 GG V PPPPPP Sbjct: 517 GGGAVPRPPPPPP 529 Score = 25.4 bits (53), Expect(2) = 7.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 776 GXGGXXVXXPPPPPP 820 G GG PPPPPP Sbjct: 516 GGGGAVPRPPPPPPP 530 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP+ P Sbjct: 527 PPPPPPPRKP 536 Score = 22.6 bits (46), Expect(2) = 7.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 911 PXPPPPPKXP 940 P PPPPP P Sbjct: 522 PRPPPPPPPP 531 >EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-peptidase protein. Length = 528 Score = 27.5 bits (58), Expect(2) = 2.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPP P P +PP PP Sbjct: 232 PPPPPLPTPPAVVTVPPATPP 252 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP PPPPPP Sbjct: 218 PPVPTITSSPAPPPPPPPP 236 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 988 PPPPXGGXGGXEKXXPRXFWGGGG 917 PPPP G G PR W GGG Sbjct: 188 PPPPMPGWNGGGPPPPRPGWNGGG 211 Score = 25.0 bits (52), Expect(2) = 2.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGGG 988 PPPP+ PPP P GG Sbjct: 200 PPPPRPGWNGGGPPPPRPGWNGG 222 Score = 24.6 bits (51), Expect(2) = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PPP G G PPPP P Sbjct: 187 GPPPPMPGWNG---GGPPPPRP 205 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 31.1 bits (67), Expect = 2.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 988 PPPPXGGXGGXEKXXPRXFWGGGG 917 PPPP G G PR W GGG Sbjct: 188 PPPPMPGWNGGGPPPPRPGWNGGG 211 Score = 25.0 bits (52), Expect(2) = 2.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGGG 988 PPPP+ PPP P GG Sbjct: 200 PPPPRPGWNGGGPPPPRPGWNGG 222 Score = 24.6 bits (51), Expect(2) = 2.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PPP G G PPPP P Sbjct: 187 GPPPPMPGWNG---GGPPPPRP 205 >BT030423-1|ABO52843.1| 506|Drosophila melanogaster IP17710p protein. Length = 506 Score = 31.1 bits (67), Expect = 2.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGGG P PPPPP Sbjct: 319 GGGGGVVGPAPPPPP 333 >BT023765-1|AAZ41773.1| 701|Drosophila melanogaster RE18252p protein. Length = 701 Score = 31.1 bits (67), Expect = 2.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGGG P PPPPP Sbjct: 514 GGGGGVVGPAPPPPP 528 >AE014298-1912|AAF48279.1| 458|Drosophila melanogaster CG15753-PA protein. Length = 458 Score = 31.1 bits (67), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 775 GGGGGXGXFXPPPPPXFF 828 GG GG PPPPP FF Sbjct: 178 GGAGGGAMMMPPPPPRFF 195 >AE014134-2732|AAN10947.1| 701|Drosophila melanogaster CG5953-PB, isoform B protein. Length = 701 Score = 31.1 bits (67), Expect = 2.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGGG P PPPPP Sbjct: 514 GGGGGVVGPAPPPPP 528 >AE014134-2731|AAF53541.2| 701|Drosophila melanogaster CG5953-PA, isoform A protein. Length = 701 Score = 31.1 bits (67), Expect = 2.8 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 818 GGGGGXKXPXPPPPP 774 GGGGG P PPPPP Sbjct: 514 GGGGGVVGPAPPPPP 528 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 26.6 bits (56), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP PPP P Sbjct: 192 PKPPPPPPPKAAPRPPPPAP 211 Score = 22.6 bits (46), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 185 PPPAAG-----APKPPPPPP 199 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 26.6 bits (56), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP PPP P Sbjct: 192 PKPPPPPPPKAAPRPPPPAP 211 Score = 22.6 bits (46), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 185 PPPAAG-----APKPPPPPP 199 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 26.6 bits (56), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP PPP P Sbjct: 192 PKPPPPPPPKAAPRPPPPAP 211 Score = 22.6 bits (46), Expect(2) = 3.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 761 PPPXXGXGGXXVXXPPPPPP 820 PPP G PPPPPP Sbjct: 185 PPPAAG-----APKPPPPPP 199 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 216 GGGGGGRGGFGGRRGGGGGGG 236 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 178 GGGGGGRGGFGGRRGGGGGGG 198 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 217 GGGGGGRYDRGGGGGGGGGGG 237 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 216 GGGGGGRGGFGGRRGGGGGGG 236 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 255 GGGGGGRYDRGGGGGGGGGGG 275 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 598 PPPPPMAPS--MMPPPPPPCPG 617 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 217 GGGGGGRGGFGGRRGGGGGGG 237 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 250 GGGGGGRYDRGGGGGGGGGGG 270 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 249 GGGGGGGRYDRGGGGGGGGGG 269 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 30.7 bits (66), Expect = 3.7 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXF---XPPPP 816 G G PP GGGGG G PPPP Sbjct: 148 GPGPPPHYGGGGGGGGHMGMRGPPPP 173 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 559 PPPPPMAPS--MMPPPPPPCPG 578 >AY113393-1|AAM29398.1| 891|Drosophila melanogaster RE07247p protein. Length = 891 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXFXPPPPPXFF 828 G PPP GG G P PPP +F Sbjct: 142 GPPPPSGFSGGPYGPAKPMPPPSYF 166 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 404 PPPPPMAPS--MMPPPPPPCPG 423 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 217 GGGGGGRGGFGGRRGGGGGGG 237 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 250 GGGGGGRYDRGGGGGGGGGGG 270 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 249 GGGGGGGRYDRGGGGGGGGGG 269 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 217 GGGGGGRGGFGGRRGGGGGGG 237 Score = 30.7 bits (66), Expect = 3.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGGR G GGGGG G Sbjct: 250 GGGGGGRYDRGGGGGGGGGGG 270 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 249 GGGGGGGRYDRGGGGGGGGGG 269 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 559 PPPPPMAPS--MMPPPPPPCPG 578 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 598 PPPPPMAPS--MMPPPPPPCPG 617 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 917 PPPPPKXPXXXFLPPPXPPXXG 982 PPPPP P +PPP PP G Sbjct: 900 PPPPPMAPS--MMPPPPPPCPG 919 >AE014296-2707|AAF49484.2| 891|Drosophila melanogaster CG4998-PA, isoform A protein. Length = 891 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXFXPPPPPXFF 828 G PPP GG G P PPP +F Sbjct: 142 GPPPPSGFSGGPYGPAKPMPPPSYF 166 >AE014296-2706|ABI31256.1| 1185|Drosophila melanogaster CG4998-PB, isoform B protein. Length = 1185 Score = 30.7 bits (66), Expect = 3.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXFXPPPPPXFF 828 G PPP GG G P PPP +F Sbjct: 142 GPPPPSGFSGGPYGPAKPMPPPSYF 166 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 30.7 bits (66), Expect = 3.7 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXF---XPPPP 816 G G PP GGGGG G PPPP Sbjct: 1332 GPGPPPHYGGGGGGGGHMGMRGPPPP 1357 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 30.7 bits (66), Expect = 3.7 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 748 GXGXPPPXXGGGGGXGXF---XPPPP 816 G G PP GGGGG G PPPP Sbjct: 1374 GPGPPPHYGGGGGGGGHMGMRGPPPP 1399 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 30.3 bits (65), Expect = 4.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG G G + G FGGGGG G Sbjct: 294 PGSPGGGGFGGQGGGGGFGGGGGRG 318 Score = 30.3 bits (65), Expect = 4.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG G G + G FGGGGG G Sbjct: 360 PGSPGGGGFGGQGGGGGFGGGGGRG 384 >BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p protein. Length = 504 Score = 30.3 bits (65), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXF------XPPPPP 819 G PPP GGGG G PPPPP Sbjct: 424 GAPPPDDSGGGGAGNLKYCSIDTPPPPP 451 >BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p protein. Length = 605 Score = 30.3 bits (65), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXF------XPPPPP 819 G PPP GGGG G PPPPP Sbjct: 525 GAPPPDDSGGGGAGNLKYCSIDTPPPPP 552 >AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-PA protein. Length = 208 Score = 30.3 bits (65), Expect = 4.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 759 PPPPXXG-XGGXXSFXPPPPP 818 PPPP G G S+ PPPPP Sbjct: 91 PPPPEYGPPAGYPSYGPPPPP 111 >AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-PB, isoform B protein. Length = 504 Score = 30.3 bits (65), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXF------XPPPPP 819 G PPP GGGG G PPPPP Sbjct: 424 GAPPPDDSGGGGAGNLKYCSIDTPPPPP 451 >AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-PA, isoform A protein. Length = 605 Score = 30.3 bits (65), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +1 Query: 754 GXPPPXXGGGGGXGXF------XPPPPP 819 G PPP GGGG G PPPPP Sbjct: 525 GAPPPDDSGGGGAGNLKYCSIDTPPPPP 552 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 30.3 bits (65), Expect = 4.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG G G + G FGGGGG G Sbjct: 366 PGSPGGGGFGGQGGGGGFGGGGGRG 390 Score = 30.3 bits (65), Expect = 4.9 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 984 PPXXGGXGGGRKXXXGXFGGGGGXG 910 P GG G G + G FGGGGG G Sbjct: 432 PGSPGGGGFGGQGGGGGFGGGGGRG 456 >AE013599-1228|AAF58703.1| 120|Drosophila melanogaster CG13227-PA protein. Length = 120 Score = 30.3 bits (65), Expect = 4.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 920 PPPPKXPXXXFLPPPXPPXXGGG 988 PPP P F PP PP GGG Sbjct: 65 PPPFGPPPPPFFGPPPPPYYGGG 87 >U29608-1|AAA70336.1| 1099|Drosophila melanogaster LATS protein. Length = 1099 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPPXXF 827 PPPP GG PPPPP + Sbjct: 282 PPPPYLIQGGAGGAAPPPPPPSY 304 >L39837-1|AAA73959.1| 1099|Drosophila melanogaster tumor suppressor protein. Length = 1099 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPPXXF 827 PPPP GG PPPPP + Sbjct: 282 PPPPYLIQGGAGGAAPPPPPPSY 304 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGG 665 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGG 679 >BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p protein. Length = 1596 Score = 29.9 bits (64), Expect = 6.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PP PP GGG Sbjct: 636 PIPPPPANVPPPE--PPRSPPDYGGG 659 >BT004830-1|AAO45186.1| 821|Drosophila melanogaster SD19495p protein. Length = 821 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPPXXF 827 PPPP GG PPPPP + Sbjct: 282 PPPPYLIQGGAGGAAPPPPPPSY 304 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGG 919 P GG GGGR+ G GGGG Sbjct: 70 PYGGGFGGGRRHGGGRGGGGG 90 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGG 665 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGG 679 >AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-PB, isoform B protein. Length = 1596 Score = 29.9 bits (64), Expect = 6.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PP PP GGG Sbjct: 636 PIPPPPANVPPPE--PPRSPPDYGGG 659 >AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-PA, isoform A protein. Length = 1596 Score = 29.9 bits (64), Expect = 6.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGGG 988 P PPPP P PP PP GGG Sbjct: 636 PIPPPPANVPPPE--PPRSPPDYGGG 659 >AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-PA protein. Length = 1105 Score = 29.9 bits (64), Expect = 6.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 759 PPPPXXGXGGXXSFXPPPPPXXF 827 PPPP GG PPPPP + Sbjct: 282 PPPPYLIQGGAGGAAPPPPPPSY 304 >AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-PA protein. Length = 695 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLP--PPXPP 973 P PPPPP P +P PP PP Sbjct: 356 PPPPPPPPPPATSTIPATPPLPP 378 Score = 26.6 bits (56), Expect(2) = 9.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPP 973 P PPPPP PP PP Sbjct: 359 PPPPPPPATSTIPATPPLPPP 379 Score = 21.0 bits (42), Expect(2) = 9.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 356 PPPPPP 361 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGG 665 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G FGG GG G Sbjct: 659 GGRGGGGRGGGGGFGGRGGGG 679 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 29.9 bits (64), Expect = 6.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGG 919 P GG GGGR+ G GGGG Sbjct: 70 PYGGGFGGGRRHGGGRGGGGG 90 >AJ223300-1|CAA11241.1| 902|Drosophila melanogaster homebox protein DRx protein. Length = 902 Score = 27.5 bits (58), Expect(2) = 7.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 767 PXXGXGGXXVXXPPPPPP 820 P G GG PPPPPP Sbjct: 702 PHVGHGGHGQPQPPPPPP 719 Score = 20.6 bits (41), Expect(2) = 7.3 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 911 PXPPPPP 931 P PPPPP Sbjct: 714 PPPPPPP 720 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 26.6 bits (56), Expect(2) = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP PPP P Sbjct: 344 PPPPPPPAQTSAIPSPPPFP 363 Score = 21.4 bits (43), Expect(2) = 7.7 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = +2 Query: 737 KXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 + K P P PPPPPP Sbjct: 320 RRKSVGQCPSPVTAAPPPPPPPPPPPPP 347 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 26.6 bits (56), Expect(2) = 7.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXP 970 P PPPPP PPP P Sbjct: 344 PPPPPPPAQTSAIPSPPPFP 363 Score = 21.4 bits (43), Expect(2) = 7.7 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = +2 Query: 737 KXKXAXGXPPPXXGXGGXXVXXPPPPPP 820 + K P P PPPPPP Sbjct: 320 RRKSVGQCPSPVTAAPPPPPPPPPPPPP 347 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 27.1 bits (57), Expect(2) = 7.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PP PP PPP PP G Sbjct: 53 PPPPSPPCGRPPPGSPPPGPPPPG 76 Score = 21.0 bits (42), Expect(2) = 7.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 51 PPPPPP 56 >AY051667-1|AAK93091.1| 400|Drosophila melanogaster LD21709p protein. Length = 400 Score = 25.4 bits (53), Expect(2) = 7.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PP G PPPPPP Sbjct: 323 GPTPPGQPSGYHIYHAPPPPPP 344 Score = 22.6 bits (46), Expect(2) = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PP P G Sbjct: 339 PPPPPPPVVPM-----PPYPSSGWG 358 >AE014134-3575|AAN11147.1| 400|Drosophila melanogaster CG15218-PB, isoform B protein. Length = 400 Score = 25.4 bits (53), Expect(2) = 7.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PP G PPPPPP Sbjct: 323 GPTPPGQPSGYHIYHAPPPPPP 344 Score = 22.6 bits (46), Expect(2) = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PP P G Sbjct: 339 PPPPPPPVVPM-----PPYPSSGWG 358 >AE014134-3574|AAN11146.1| 400|Drosophila melanogaster CG15218-PA, isoform A protein. Length = 400 Score = 25.4 bits (53), Expect(2) = 7.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 755 GXPPPXXGXGGXXVXXPPPPPP 820 G PP G PPPPPP Sbjct: 323 GPTPPGQPSGYHIYHAPPPPPP 344 Score = 22.6 bits (46), Expect(2) = 7.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXGG 985 P PPPPP P PP P G Sbjct: 339 PPPPPPPVVPM-----PPYPSSGWG 358 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 27.1 bits (57), Expect(2) = 8.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P PP PP G Sbjct: 99 PPPPPPPPAP-----APPPPPGAG 117 Score = 21.0 bits (42), Expect(2) = 8.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 803 PPPPPP 820 PPPPPP Sbjct: 98 PPPPPP 103 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 71 GGGGGGGRGAFGGRGGGGGRG 91 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGGR G GGG G G Sbjct: 6 PRGGGGGGGRGFGGGGGGGGRGFG 29 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 29.5 bits (63), Expect = 8.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 972 GGXGGGRKXXXGXFGGGGGXG 910 GG GGG + G GGGGG G Sbjct: 64 GGGGGGGRGAFGGRGGGGGRG 84 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 29.5 bits (63), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 981 PXXGGXGGGRKXXXGXFGGGGGXG 910 P GG GGGR G GGG G G Sbjct: 6 PRGGGGGGGRGFGGGGGGGGRGFG 29 >AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p protein. Length = 1052 Score = 25.0 bits (52), Expect(2) = 9.4 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPPPPPKXPXXX--FLPPPXP 970 P PPPPP+ LPPP P Sbjct: 132 PPPPPPPQQQQQLPQQLPPPTP 153 Score = 22.6 bits (46), Expect(2) = 9.4 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP + PPPPPP Sbjct: 120 PPPQPITSCPLSPPPPPPP 138 >AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB, isoform B protein. Length = 1052 Score = 25.0 bits (52), Expect(2) = 9.4 Identities = 11/22 (50%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 911 PXPPPPPKXPXXX--FLPPPXP 970 P PPPPP+ LPPP P Sbjct: 132 PPPPPPPQQQQQLPQQLPPPTP 153 Score = 22.6 bits (46), Expect(2) = 9.4 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 764 PPXXGXGGXXVXXPPPPPP 820 PP + PPPPPP Sbjct: 120 PPPQPITSCPLSPPPPPPP 138 >BT003217-1|AAO24972.1| 824|Drosophila melanogaster RE10170p protein. Length = 824 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + P P P G Sbjct: 49 PPPPPPPSLP--VWTPQPSPVLSG 70 Score = 21.8 bits (44), Expect(2) = 9.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G PPPPPP Sbjct: 43 GATSATPPPPPPP 55 >AE013599-1059|AAM68778.1| 824|Drosophila melanogaster CG18408-PC, isoform C protein. Length = 824 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + P P P G Sbjct: 49 PPPPPPPSLP--VWTPQPSPVLSG 70 Score = 21.8 bits (44), Expect(2) = 9.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G PPPPPP Sbjct: 43 GATSATPPPPPPP 55 >AB053480-1|BAB62019.1| 824|Drosophila melanogaster DCAPL3 protein. Length = 824 Score = 25.8 bits (54), Expect(2) = 9.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + P P P G Sbjct: 49 PPPPPPPSLP--VWTPQPSPVLSG 70 Score = 21.8 bits (44), Expect(2) = 9.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G PPPPPP Sbjct: 43 GATSATPPPPPPP 55 >AE013599-1060|AAF58815.2| 811|Drosophila melanogaster CG18408-PF, isoform F protein. Length = 811 Score = 25.8 bits (54), Expect(2) = 9.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 911 PXPPPPPKXPXXXFLPPPXPPXXG 982 P PPPPP P + P P P G Sbjct: 36 PPPPPPPSLP--VWTPQPSPVLSG 57 Score = 21.8 bits (44), Expect(2) = 9.6 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 782 GGXXVXXPPPPPP 820 G PPPPPP Sbjct: 30 GATSATPPPPPPP 42 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,389,627 Number of Sequences: 53049 Number of extensions: 1228753 Number of successful extensions: 18216 Number of sequences better than 10.0: 142 Number of HSP's better than 10.0 without gapping: 2962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13359 length of database: 24,988,368 effective HSP length: 86 effective length of database: 20,426,154 effective search space used: 5719323120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -