BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H09 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 39 8e-04 SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 36 0.006 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 36 0.006 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 39.1 bits (87), Expect = 8e-04 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +2 Query: 182 DDVAVTXEXXSXXLKAGXVYVEPYWXILFAXXLXGXXVRDLITNXGS 322 + + +T + KAG V VEP W +FA L G +++L+ N GS Sbjct: 18 EGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELLLNIGS 64 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 36.3 bits (80), Expect = 0.006 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 182 DDVAVTXEXXSXXLKAGXVYVEPYWXILFAXXLXGXXVRDLITNXGS 322 + + +T + KA V VEP W +FA L G +++L+ N GS Sbjct: 18 EGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLLNIGS 64 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 36.3 bits (80), Expect = 0.006 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 182 DDVAVTXEXXSXXLKAGXVYVEPYWXILFAXXLXGXXVRDLITNXGS 322 + + +T + KA V VEP W +FA L G +++L+ N GS Sbjct: 18 EGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLLNIGS 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,035,001 Number of Sequences: 5004 Number of extensions: 7604 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -