BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H09 (879 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal pro... 47 2e-05 U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal prote... 43 3e-04 >AC087079-6|AAK27864.1| 111|Caenorhabditis elegans Ribosomal protein, acidic protein 1 protein. Length = 111 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +2 Query: 182 DDVAVTXEXXSXXLKAGXVYVEPYWXILFAXXLXGXXVRDLITNXGS 322 D+VA+T E + LKA V EPYW LFA L G V++LIT+ S Sbjct: 19 DEVAITGEKIATLLKAANVEFEPYWPGLFAKALEGVDVKNLITSVSS 65 >U89307-1|AAB48625.1| 111|Caenorhabditis elegans ribosomal protein P1 homolog protein. Length = 111 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = +2 Query: 182 DDVAVTXEXXSXXLKAGXVYVEPYWXILFAXXLXGXXVRDLITNXGS 322 D+VA+T E + LKA V EP W LFA L G V++LIT+ S Sbjct: 19 DEVAITGEKIATLLKAANVEFEPNWPGLFAKALEGVDVKNLITSVSS 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,818,079 Number of Sequences: 27780 Number of extensions: 45285 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2213393798 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -