BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H05 (848 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 31 0.97 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 31 0.97 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect = 0.97 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +3 Query: 690 PPXLXGXXTPFGXFXXGGGF*RPPXXGVTPPXGVXXGXPPPXXXPKKXSPP 842 PP PFG G PP G+ PP G PPP + PP Sbjct: 161 PPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPP 211 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 31.1 bits (67), Expect = 0.97 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +3 Query: 690 PPXLXGXXTPFGXFXXGGGF*RPPXXGVTPPXGVXXGXPPPXXXPKKXSPP 842 PP PFG G PP G+ PP G PPP + PP Sbjct: 161 PPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPP 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,883,271 Number of Sequences: 28952 Number of extensions: 183139 Number of successful extensions: 934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -