BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H04 (859 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 29 0.64 SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 27 2.6 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 29.5 bits (63), Expect = 0.64 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 205 LSLVHSEVQQYTRRATPVPDEVGGVGRPPSAG 300 L+L+HS ++ + PV +E RPP+AG Sbjct: 555 LNLIHSSNNEFMKSIFPVAEESNSRRRPPTAG 586 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 283 RPPSAGPGRAL*KRHGRGAPLYGPSNKYTSRT 378 +PP +GPG R RG ++G S + SR+ Sbjct: 86 QPPPSGPGSKRGGRRERGGRVHGDSGRLRSRS 117 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,945,952 Number of Sequences: 5004 Number of extensions: 52498 Number of successful extensions: 146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -