BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_H02 (831 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) 29 3.5 SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) 29 4.6 SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) 28 8.1 SB_22160| Best HMM Match : Arc (HMM E-Value=7.5) 28 8.1 >SB_15782| Best HMM Match : DUF845 (HMM E-Value=5.8) Length = 283 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 183 GFEENLMRNWVCLVEHESSRDTSKTN 260 GFEE + R W+ + E S D +KTN Sbjct: 33 GFEEEVKRQWIGCDKLEGSNDITKTN 58 >SB_2235| Best HMM Match : Arf (HMM E-Value=3.1e-13) Length = 334 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 176 ETWLRRKSHEELGMSGRAREQP*HVQDEHEP 268 E WL RK H E +S RE+ V+++H+P Sbjct: 223 EAWLERKEHREDSLSEHEREE---VKNKHKP 250 >SB_9094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 510 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/78 (28%), Positives = 35/78 (44%) Frame = +3 Query: 180 HGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVK 359 H + +++W+ + E RDT+ N + ++N+ W K K +VK Sbjct: 53 HEADPVAVKSWLKKLSEEQFRDTADKYLRPNNCSHVVVPKVNEEIW-GKLTRQVKTKDVK 111 Query: 360 CSDLLTDDITKAAKCAKK 413 S L T +ITKA A K Sbjct: 112 FSRLQT-NITKAGHIAVK 128 >SB_40345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1250 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 38 DFWIIQLL*LERYDRNAEVNYFRFG 112 D+W++++ L R+ RN NY+ +G Sbjct: 715 DWWLLKVTKLPRHQRNEASNYYTYG 739 >SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) Length = 421 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 565 ALSTQVCFEEIESKV*LKFTVEFSSC*YQ-VRSPWQW 458 +LS Q E+IES L + SC YQ ++ WQW Sbjct: 338 SLSGQAILEKIESGYRLPAPAKLPSCVYQLMKDCWQW 374 >SB_22160| Best HMM Match : Arc (HMM E-Value=7.5) Length = 246 Score = 28.3 bits (60), Expect = 8.1 Identities = 19/71 (26%), Positives = 30/71 (42%) Frame = +3 Query: 111 VVLCVGSEAKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYG 290 VV G + + + + L++ GF +L + V + +S K RNG K Sbjct: 41 VVKVTGGRSNSSSHEDVAQSLKRSGFLYDLTESSV--IPTATSATYRKFRLKRNGMKKTE 98 Query: 291 LFQINDRYWCS 323 F+ R WCS Sbjct: 99 FFKYLRRKWCS 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,270,911 Number of Sequences: 59808 Number of extensions: 428781 Number of successful extensions: 928 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -