BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G20 (850 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54718| Best HMM Match : Palm_thioest (HMM E-Value=1.8e-07) 73 2e-13 SB_51899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_36099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_53079| Best HMM Match : TPR_1 (HMM E-Value=0) 29 3.6 SB_41119| Best HMM Match : Sec23_helical (HMM E-Value=7.4e-37) 29 4.8 SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_31109| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.073) 29 6.3 SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 >SB_54718| Best HMM Match : Palm_thioest (HMM E-Value=1.8e-07) Length = 144 Score = 73.3 bits (172), Expect = 2e-13 Identities = 41/93 (44%), Positives = 51/93 (54%), Gaps = 11/93 (11%) Frame = +3 Query: 540 KGIYGIPHCGALRHETCDDVRKLLNYAAYNSWVQNSLVQATYWHDPLXERTYEANSVFLA 719 +G+YG PHC C+ VR+LLN AY S LVQA YWHDP+ E+ Y S+FLA Sbjct: 12 QGVYGFPHCPGDNSTLCNYVRELLNIGAYVS-----LVQAEYWHDPMNEKEYRDKSIFLA 66 Query: 720 DINN-----------VRTVNKTYIQNLNNLXRF 785 DIN ++T N TY +NL L F Sbjct: 67 DINQEKFTLQRLIFVLQTKNPTYKENLMKLKNF 99 >SB_51899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 873 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 252 SWFLQNIPREEHTWCLCSVS 311 +WF + R +H++CLCSVS Sbjct: 815 TWFAGELMRRKHSYCLCSVS 834 >SB_36099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -1 Query: 388 IHIQLGDSGS*NIHFQNLQQYYCQFGETEHKHQVCSSLGI 269 ++ LGD+G ++++N Y +FGE + V S++GI Sbjct: 238 VYKSLGDNGQAMVNYKNALCIYEKFGEEREQADVYSNIGI 277 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 388 IHIQLGDSGS*NIHFQNLQQYYCQFGETEHKHQVCSSLGI 269 I+ LGD G ++++N Y +FGE + V S++G+ Sbjct: 158 IYSSLGDDGQAILNYKNALCIYEKFGEKREQADVYSNIGL 197 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +1 Query: 202 PIVLWHGMGDTCCMSFSLGSFKIFLEKNIPGVYVL-SLQIGNNTVEDFENGYFMN-PNLQ 375 P +HG+ + + K F E+ + G L SLQ+ NN + E G F N L+ Sbjct: 156 PETTFHGLAALQRLRLHNNNLKTFSERTLQGTLSLKSLQLNNNLLTRIEPGTFRNLRGLE 215 Query: 376 VEYV 387 + Y+ Sbjct: 216 ILYL 219 >SB_53079| Best HMM Match : TPR_1 (HMM E-Value=0) Length = 772 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -1 Query: 388 IHIQLGDSGS*NIHFQNLQQYYCQFGETEHKHQVCSSLGI 269 + I LGD+G ++F+N Y +FGE + V +++GI Sbjct: 310 VFISLGDNGQAMVNFKNALCIYEKFGEECKQADVYNNIGI 349 >SB_41119| Best HMM Match : Sec23_helical (HMM E-Value=7.4e-37) Length = 875 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/68 (20%), Positives = 30/68 (44%) Frame = +3 Query: 492 INYHKLKTWCLSEVSTKGIYGIPHCGALRHETCDDVRKLLNYAAYNSWVQNSLVQATYWH 671 + Y+ +T+ + + + + + H T +L+ ++ + L+Q TY H Sbjct: 25 VQYYTQQTYATGTIHNRLMQQVQYYTQQTHSTGTIHNRLIQQVLSTTYRHDVLLQTTYRH 84 Query: 672 DPLXERTY 695 D L + TY Sbjct: 85 DVLLQTTY 92 >SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 403 PLTSHIHIQLGDSGS*NIHFQNLQQYYCQFGETEHKH 293 PLT H HI+L + +I + Q + + T+H H Sbjct: 206 PLTQHTHIRLPSTQHTHIRLPSTQHSHIRLPSTQHSH 242 >SB_31109| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.073) Length = 582 Score = 28.7 bits (61), Expect = 6.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 243 HAACVTHAVPQDDGCRRCAY 184 H C H V + DGCR C Y Sbjct: 81 HKPCCHHKVEKPDGCRLCRY 100 >SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/40 (27%), Positives = 25/40 (62%) Frame = -1 Query: 388 IHIQLGDSGS*NIHFQNLQQYYCQFGETEHKHQVCSSLGI 269 +++ LGD+G ++++N Y +FGE + V +++G+ Sbjct: 157 LYMTLGDNGQAMVNYKNALCIYEKFGEERKQADVYNNIGV 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,803,778 Number of Sequences: 59808 Number of extensions: 531108 Number of successful extensions: 1111 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -