BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G20 (850 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 29 0.24 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 27 0.72 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 5.1 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 5.1 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 28.7 bits (61), Expect = 0.24 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -3 Query: 506 FVVVYDHIFVLQLE*TDIPCEKPMTLNPFDSFGSAANFSHTYST 375 F+ Y+H V+QL + IPC P +N +++ YST Sbjct: 55 FLPKYEHTHVMQLSTSAIPCCSPKKMNSIRLLYFDMSYNVIYST 98 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 27.1 bits (57), Expect = 0.72 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 605 LPHIITCFVSQGTTMRYAIDA 543 +PH+ C +S GTT RY A Sbjct: 394 VPHVSQCPISPGTTFRYTFRA 414 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 5.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 346 NGYFMNPNLQVEYVCEKLAADPKLSNGFNVMGFSQGMSVYSSCSTKM 486 +G P+ + E + AAD + +G F Q +S CST++ Sbjct: 424 HGPIQLPHSESEELSMSTAADTAVPSGIKSPAFKQPAFSHSVCSTEV 470 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 5.1 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 346 NGYFMNPNLQVEYVCEKLAADPKLSNGFNVMGFSQGMSVYSSCSTKM 486 +G P+ + E + AAD + +G F Q +S CST++ Sbjct: 424 HGPIQLPHSESEELSMSTAADTAVPSGIKSPAFKQPAFSHSVCSTEV 470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 869,860 Number of Sequences: 2352 Number of extensions: 18000 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -