BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G18 (937 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 111 4e-26 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 111 bits (266), Expect = 4e-26 Identities = 55/109 (50%), Positives = 63/109 (57%) Frame = +1 Query: 202 LGDLLRALNSNPTLATIXXXXXXXXXXXXXXXXXXFLPIYSQAKKDKDQGAYEDFLECLK 381 LG+ LRALN NPT+ I FLPI+SQ KK+K+QG +EDFLECLK Sbjct: 33 LGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEFLPIFSQVKKEKEQGCFEDFLECLK 92 Query: 382 LYDKNENGLMXXXXXXXXXXXXXXXXDDSEVAEVTKDCMDPEDDDGMIP 528 LYDKNE+G M DD E+ V KDCMDPEDDDG IP Sbjct: 93 LYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPEDDDGNIP 141 Score = 46.4 bits (105), Expect = 1e-06 Identities = 18/42 (42%), Positives = 29/42 (69%) Frame = +3 Query: 111 SDLSKNDVERASFAFSIYDFEGKGKIDAFNLGRSPESAQLKP 236 +DL ++E+A F FS+YD+EG G++DA +LG + + L P Sbjct: 3 NDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNP 44 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,619 Number of Sequences: 2352 Number of extensions: 13869 Number of successful extensions: 255 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 102122397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -