BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G16 (873 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0238 - 32570222-32570330,32570538-32570599,32570658-325708... 29 4.9 01_03_0015 + 11669321-11670070 28 8.5 >03_06_0238 - 32570222-32570330,32570538-32570599,32570658-32570883, 32571165-32571532,32571644-32571743,32571817-32571879, 32573077-32573123,32573222-32573353 Length = 368 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 142 DDPKNIKRPCPNFDLNCIREYFSRNSQCQLVRGPVPDPLPLS 267 +DP + + L CI E+ R+SQC + P+ P+S Sbjct: 40 NDPSTVTSCKHEYHLQCILEWCQRSSQCPMCWQPISMKDPMS 81 >01_03_0015 + 11669321-11670070 Length = 249 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +1 Query: 109 AVAFGENLDPADDPKNIKRPCPNFDLNCIREYFSRNSQCQLVRGPVPDP 255 AV E + D + + R F + CI +F NS C L R V P Sbjct: 148 AVCLAE-FEAGDKARALPRCGHRFHVECIDAWFRENSTCPLCRADVEAP 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,344,918 Number of Sequences: 37544 Number of extensions: 326603 Number of successful extensions: 761 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2456227356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -