BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G15 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 4.1 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 4.1 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 7.1 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 9.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.4 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 18 HYREFLRFKCGE 53 HY EF+R++ GE Sbjct: 403 HYEEFVRYELGE 414 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 622 QTFINKFVXGFNSIKSSG 569 QTF N + GF ++ SG Sbjct: 118 QTFSNLNISGFGGVQESG 135 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = -1 Query: 331 YL*EISSFILKVSSYSIKKEKKTAL*QSVRIDQCFPIKSIEVASKKNIV 185 ++ + + L +S ++ +E KT L + +I Q FP + ++ N+V Sbjct: 258 FMINVGTVTLILSCDAVLEEVKTTLLLAYKIRQVFPNEKKNISEFINVV 306 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 354 DRNEFLHINTTVPDLIRLHEN 416 ++ + HI TT + IR+H + Sbjct: 132 EKQSYFHIATTSNEFIRVHHS 152 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 630 NCYLVKCDXXVDFNFXLFHLXPNY 701 N Y++ D +DF HL +Y Sbjct: 154 NTYILALDGDIDFQPEALHLLVDY 177 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 630 NCYLVKCDXXVDFNFXLFHLXPNY 701 N Y++ D +DF HL +Y Sbjct: 468 NTYILALDGDIDFQPEALHLLVDY 491 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 630 NCYLVKCDXXVDFNFXLFHLXPNY 701 N Y++ D +DF HL +Y Sbjct: 701 NTYILALDGDIDFQPEALHLLVDY 724 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 630 NCYLVKCDXXVDFNFXLFHLXPNY 701 N Y++ D +DF HL +Y Sbjct: 701 NTYILALDGDIDFQPEALHLLVDY 724 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,823 Number of Sequences: 336 Number of extensions: 2677 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -