BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G10 (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 4.0 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 4.0 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 24 5.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 5.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 24 7.0 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.2 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 4.0 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +3 Query: 189 CGKSVYAAEERVAGGLKWHKMCFKCGLCQKLLDSTNCSEHEGEL 320 C KS+Y A E AG +H + + ++L N + GE+ Sbjct: 543 CDKSIYTAVEVTAGNRLFHHIVESDRVGTQILKEMNKQKLPGEV 586 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.6 bits (51), Expect = 4.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 579 KCGDCMKRLDSTNCCEGSDKDIYCKVC 659 +C C++R +T C G D+ C C Sbjct: 290 RCFRCLERGHTTADCAGEDRSSLCLHC 316 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 24.2 bits (50), Expect = 5.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 262 HLKHILCHLRPPATRSSAA*TDLPHFGHFGL 170 HL + P + SS TDLPH H+ L Sbjct: 477 HLSRHASSILPSSLVSSPDGTDLPHHTHYQL 507 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.2 bits (50), Expect = 5.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 262 HLKHILCHLRPPATRSSAA*TDLPHFGHFGL 170 HL + P + SS TDLPH H+ L Sbjct: 453 HLSRHASSILPSSLVSSPDGTDLPHHTHYQL 483 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.8 bits (49), Expect = 7.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 489 PGEGCPRCGGYVYAAEQMLARGRAWHK 569 P CPRC G V + +L + +H+ Sbjct: 946 PSAECPRCPGSVESVAHVLFQCEVFHE 972 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 67 ASPP*TVHAFGSSTLVPTRRT 129 ASPP +H GS T +RT Sbjct: 879 ASPPAAIHGGGSRTTTVLKRT 899 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,228 Number of Sequences: 2352 Number of extensions: 17424 Number of successful extensions: 49 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -