BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G10 (877 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 24 2.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 2.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 4.9 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 4.9 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 4.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.5 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.8 bits (49), Expect = 2.1 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +1 Query: 205 TPLRSAWLVASNGTKCASNVVCAKNCWTQPTAQSTRVNCTAK 330 +PL+ + T + +V NC P +T CTA+ Sbjct: 391 SPLKREGGPPTGATTGPNEIVTCTNCGPNPCTHTTTNGCTAE 432 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.8 bits (49), Expect = 2.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 84 CTRVRELDSRSDSTNRIS*ASTMPFKPADN 173 C R R+LDS SDS I + P KPA + Sbjct: 568 CPRFRKLDSPSDS--GIESGTEKPDKPASS 595 Score = 22.6 bits (46), Expect = 4.9 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +3 Query: 411 HLKGENAGGVRTNGACLEPRSIAKAPPGEGCPR 509 H + N+G + L S++K P CPR Sbjct: 538 HRRRANSGSTSSGDDELHRASLSKTPQPPQCPR 570 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 3.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 527 VHIATAARTALAGRSFSDRAGLQTS 453 VH T++ +A G +DR G ++S Sbjct: 411 VHHTTSSSSAAGGEGLADRRGSESS 435 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 235 SNGTKCASNVVCAKNCWTQPTAQSTRVNCTAK 330 + T + +V NC P +T CTA+ Sbjct: 415 TGATTGPNEIVTCTNCGPNPCTHTTTNGCTAE 446 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 235 SNGTKCASNVVCAKNCWTQPTAQSTRVNCTAK 330 + T + +V NC P +T CTA+ Sbjct: 435 TGATTGPNEIVTCTNCGPNPCTHTTTNGCTAE 466 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 235 SNGTKCASNVVCAKNCWTQPTAQSTRVNCTAK 330 + T + +V NC P +T CTA+ Sbjct: 384 TGATTGPNEIVTCTNCGPNPCTHTTTNGCTAE 415 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 343 RAWHTLQYSSPSCSEQLVESSN 278 R W L+Y+ PS + +ES + Sbjct: 1195 RFWERLRYAIPSAGDISIESKS 1216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,777 Number of Sequences: 438 Number of extensions: 4466 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -