BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G07 (877 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 5.4 At5g44780.1 68418.m05488 expressed protein low similarity to SP|... 28 7.1 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 28 7.1 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 28 7.1 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 28 7.1 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.4 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 174 PYIVN--PPKDYNPNGNG-YEPIDNGAYYVDPPQGRPYFKPTPFP 299 PY+ N PP Y+P+ Y+ Y PP PY+ PTP P Sbjct: 612 PYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPTPKP 654 >At5g44780.1 68418.m05488 expressed protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 723 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +3 Query: 198 DYNP-NGNGYEPIDNGAYYVDPPQGR 272 +Y+P NG Y P G +Y PPQG+ Sbjct: 530 NYSPQNGGHYGPAQFGQWYPGPPQGQ 555 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = +3 Query: 126 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPF 296 A N Q P + P P NP N Y+ +YYV P +PT F Sbjct: 790 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 846 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = +3 Query: 126 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPF 296 A N Q P + P P NP N Y+ +YYV P +PT F Sbjct: 792 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 848 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 198 DYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 299 DY P+ Y+P N Y PP Y +P +P Sbjct: 101 DYQPSPYPYQPQGNFGAYGPPPPHYSYQEPAQYP 134 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 189 PPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 299 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,010,268 Number of Sequences: 28952 Number of extensions: 282602 Number of successful extensions: 770 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -