BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G06 (896 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P48588 Cluster: 40S ribosomal protein S25; n=86; Eukary... 141 2e-32 UniRef50_P62851 Cluster: 40S ribosomal protein S25; n=42; Eutele... 113 6e-24 UniRef50_A3BVR1 Cluster: Putative uncharacterized protein; n=3; ... 93 1e-17 UniRef50_Q5KGY5 Cluster: Ribosomal protein, putative; n=7; Dikar... 91 5e-17 UniRef50_A7AS55 Cluster: Ribosomal protein S25 , putative; n=1; ... 72 2e-11 UniRef50_Q3E792 Cluster: 40S ribosomal protein S25-A precursor; ... 70 7e-11 UniRef50_Q9N9V4 Cluster: 40S ribosomal protein S25; n=8; Trypano... 67 5e-10 UniRef50_Q5CTY4 Cluster: 40S ribosomal protein S25; n=4; Apicomp... 66 9e-10 UniRef50_Q00XY1 Cluster: Ribosomal protein S25, cytosolic-tomato... 62 1e-08 UniRef50_O15597 Cluster: Ribosomal protein S25; n=3; Entamoeba h... 58 4e-07 UniRef50_UPI00001613CE Cluster: PREDICTED: similar to 40S riboso... 53 9e-06 UniRef50_A0C3V6 Cluster: Chromosome undetermined scaffold_148, w... 46 0.001 UniRef50_Q8ZVP1 Cluster: 30S ribosomal protein S25e; n=4; Pyroba... 39 0.20 UniRef50_Q95XW8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.9 UniRef50_Q54PB6 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_Q9Y914 Cluster: 30S ribosomal protein S25e; n=1; Aeropy... 34 5.7 UniRef50_A2BLT6 Cluster: 30S ribosomal protein S25e; n=1; Hypert... 33 7.5 UniRef50_Q80XE3 Cluster: BC051076 protein; n=3; Murinae|Rep: BC0... 33 9.9 UniRef50_Q1YII8 Cluster: Possible regulatory protein; n=1; Auran... 33 9.9 >UniRef50_P48588 Cluster: 40S ribosomal protein S25; n=86; Eukaryota|Rep: 40S ribosomal protein S25 - Drosophila melanogaster (Fruit fly) Length = 117 Score = 141 bits (342), Expect = 2e-32 Identities = 67/74 (90%), Positives = 71/74 (95%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 368 LNNQVLFDK TYEKLYKEVP YKLITP+VVSERLK+RGSLA+RALIELREKGLIKQVVQH Sbjct: 43 LNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQH 102 Query: 369 HGQVIYTRATKGDD 410 H QVIYTRATKGD+ Sbjct: 103 HSQVIYTRATKGDE 116 Score = 50.4 bits (115), Expect = 6e-05 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +2 Query: 65 PPKKDAKASAKQPQKTQKKKEGS 133 PPKKDAK+SAKQPQKTQKKKEGS Sbjct: 2 PPKKDAKSSAKQPQKTQKKKEGS 24 >UniRef50_P62851 Cluster: 40S ribosomal protein S25; n=42; Euteleostomi|Rep: 40S ribosomal protein S25 - Homo sapiens (Human) Length = 125 Score = 113 bits (272), Expect = 6e-24 Identities = 58/77 (75%), Positives = 61/77 (79%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 368 LNN VLFDK TY+KL KEVP YKLITPAVVSERLK+RGSLAR AL EL KGLIK V +H Sbjct: 44 LNNLVLFDKATYDKLCKEVPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKH 103 Query: 369 HGQVIYTRATKGDDPVA 419 QVIYTR TKG D A Sbjct: 104 RAQVIYTRNTKGGDAPA 120 >UniRef50_A3BVR1 Cluster: Putative uncharacterized protein; n=3; Magnoliophyta|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 234 Score = 92.7 bits (220), Expect = 1e-17 Identities = 43/70 (61%), Positives = 55/70 (78%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 368 +NN VLFD+ TY+KL EVP+YK ITP+V+SERL++ GSLARRA+ +L +GLI+ V H Sbjct: 163 VNNSVLFDQATYDKLLSEVPKYKQITPSVLSERLRINGSLARRAINDLMTRGLIRMVSVH 222 Query: 369 HGQVIYTRAT 398 Q IYTRAT Sbjct: 223 SSQQIYTRAT 232 >UniRef50_Q5KGY5 Cluster: Ribosomal protein, putative; n=7; Dikarya|Rep: Ribosomal protein, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 107 Score = 90.6 bits (215), Expect = 5e-17 Identities = 40/69 (57%), Positives = 55/69 (79%) Frame = +3 Query: 192 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHH 371 NN V+ DK Y+++ KEVP YKLI+ +V+ +R+K+ GSLARRA+ L ++GLIK+VV HH Sbjct: 37 NNAVIVDKAVYDRIIKEVPTYKLISQSVLIDRMKINGSLARRAIAFLEKEGLIKRVVHHH 96 Query: 372 GQVIYTRAT 398 Q+IYTRAT Sbjct: 97 AQLIYTRAT 105 >UniRef50_A7AS55 Cluster: Ribosomal protein S25 , putative; n=1; Babesia bovis|Rep: Ribosomal protein S25 , putative - Babesia bovis Length = 104 Score = 72.1 bits (169), Expect = 2e-11 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Frame = +3 Query: 192 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVV-QH 368 N+ V FDK TY+KL ++P+ +LIT + + ++LKV S+AR+AL L E+ LIK V QH Sbjct: 36 NHAVFFDKATYDKLMSDIPKARLITISTIVDKLKVNASMARKALAHLEEQKLIKPVCDQH 95 Query: 369 HGQVIYTRA 395 H Q +YT+A Sbjct: 96 HAQRLYTKA 104 >UniRef50_Q3E792 Cluster: 40S ribosomal protein S25-A precursor; n=24; Eukaryota|Rep: 40S ribosomal protein S25-A precursor - Saccharomyces cerevisiae (Baker's yeast) Length = 108 Score = 70.1 bits (164), Expect = 7e-11 Identities = 31/69 (44%), Positives = 49/69 (71%) Frame = +3 Query: 201 VLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQV 380 V+ D+ Y+++ KEVP Y+ ++ +V+ +RLK+ GSLAR AL L ++G+IK + +H Q Sbjct: 40 VILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQA 99 Query: 381 IYTRATKGD 407 IYTRAT + Sbjct: 100 IYTRATASE 108 >UniRef50_Q9N9V4 Cluster: 40S ribosomal protein S25; n=8; Trypanosomatidae|Rep: 40S ribosomal protein S25 - Leishmania infantum Length = 120 Score = 67.3 bits (157), Expect = 5e-10 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQH 368 L N V+FDK TY+KL EVP+YKLITP+++S+RLK+ S+A L +L + LI+ V Sbjct: 36 LQNAVMFDKETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGLKQLCREKLIRLVSCS 95 Query: 369 HGQVIYTR 392 +YTR Sbjct: 96 SKTRVYTR 103 >UniRef50_Q5CTY4 Cluster: 40S ribosomal protein S25; n=4; Apicomplexa|Rep: 40S ribosomal protein S25 - Cryptosporidium parvum Iowa II Length = 106 Score = 66.5 bits (155), Expect = 9e-10 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = +3 Query: 192 NNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQV-VQH 368 N+ VLFDK T ++ + +V + +L+TPAVV +LKV S AR L + KG+IK V Q Sbjct: 38 NHSVLFDKKTADRFHSDVLKSRLLTPAVVVNQLKVNASAARAMLRDCESKGIIKPVGEQT 97 Query: 369 HGQVIYTRA 395 HGQ+IYT+A Sbjct: 98 HGQMIYTKA 106 >UniRef50_Q00XY1 Cluster: Ribosomal protein S25, cytosolic-tomato sp|P46301|RS25_LYCES 40S ribosomal protein S25 p; n=1; Ostreococcus tauri|Rep: Ribosomal protein S25, cytosolic-tomato sp|P46301|RS25_LYCES 40S ribosomal protein S25 p - Ostreococcus tauri Length = 82 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/57 (50%), Positives = 41/57 (71%) Frame = +3 Query: 219 TYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYT 389 TY+KL EVP+YK+IT AV+ +RL++ SLAR+ + L+ KGLIK +V H +YT Sbjct: 20 TYDKLLAEVPKYKMITTAVLCDRLRITCSLARKGIAILQAKGLIKPLVSHAALNVYT 76 >UniRef50_O15597 Cluster: Ribosomal protein S25; n=3; Entamoeba histolytica|Rep: Ribosomal protein S25 - Entamoeba histolytica Length = 129 Score = 57.6 bits (133), Expect = 4e-07 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQV-VQ 365 LNN V+FDK T +K K+VP K+ITP VV++R+ + G+L + L L +K LI V V Sbjct: 39 LNNTVIFDKATLDKCAKDVPSMKVITPPVVADRITITGALGKILLKALDKKELIVPVKVD 98 Query: 366 HHGQVIYTRATK 401 +H +V ++R+ K Sbjct: 99 YHIRV-FSRSDK 109 >UniRef50_UPI00001613CE Cluster: PREDICTED: similar to 40S ribosomal protein S25; n=4; Euarchontoglires|Rep: PREDICTED: similar to 40S ribosomal protein S25 - Homo sapiens Length = 102 Score = 53.2 bits (122), Expect = 9e-06 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 285 RLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATKGDD 410 RL++RGSLAR AL EL KGLIK V +H +VIYTR TK D Sbjct: 53 RLEIRGSLARAALQELLGKGLIKLVSKHRARVIYTRNTKSGD 94 >UniRef50_A0C3V6 Cluster: Chromosome undetermined scaffold_148, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_148, whole genome shotgun sequence - Paramecium tetraurelia Length = 204 Score = 46.4 bits (105), Expect = 0.001 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = +3 Query: 189 LNNQVLFDKPTYEKLYKEVPQY-KLITPAVVSERLKVRGSLARRALIELREKGLIKQV-V 362 LNN V D +Y+++ ++P+ LIT + VS++ KV GSLARR + + GL+ Sbjct: 103 LNNAVFLDNTSYKQIETQLPKMGALITVSTVSDKFKVNGSLARRCIRHFAKSGLLVPAGD 162 Query: 363 QHHGQVIYT 389 Q+ Q I+T Sbjct: 163 QNSKQYIFT 171 >UniRef50_Q8ZVP1 Cluster: 30S ribosomal protein S25e; n=4; Pyrobaculum|Rep: 30S ribosomal protein S25e - Pyrobaculum aerophilum Length = 110 Score = 38.7 bits (86), Expect = 0.20 Identities = 21/68 (30%), Positives = 39/68 (57%) Frame = +3 Query: 198 QVLFDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQ 377 QVL D+ ++ + KEV ++ITP ++ + ++ S+A + L L+E+G + V + H Sbjct: 43 QVL-DEKVFQAIAKEVQNMRVITPYEIASKYGIKMSVAFKVLRNLKERGDLVLVAKGHRT 101 Query: 378 VIYTRATK 401 IY A + Sbjct: 102 EIYVPAKR 109 >UniRef50_Q95XW8 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 679 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +2 Query: 71 KKDAKASAKQPQKTQKKKEGSRWRQSQEEEVVQRKSS*QVEQ 196 KK++K+ K P+KT K+E +EEEVV++K S ++ + Sbjct: 347 KKNSKSPKKTPKKTAVKEESEESSGDEEEEVVKKKKSSKINK 388 >UniRef50_Q54PB6 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 766 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +2 Query: 23 YREFLRFVFPIQRCPPKKDAKASAKQPQKTQKKKEGSRWRQSQEEEVVQRKSS*QVEQ 196 + EFL +F I+ + +QPQ+TQ ++ + +Q+Q+ + Q Q +Q Sbjct: 290 FNEFLNSIFKIENIQQQSQQVQQTQQPQQTQHAQQAQQAQQAQQAQQTQHAQQTQQQQ 347 >UniRef50_Q9Y914 Cluster: 30S ribosomal protein S25e; n=1; Aeropyrum pernix|Rep: 30S ribosomal protein S25e - Aeropyrum pernix Length = 103 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/54 (29%), Positives = 33/54 (61%) Frame = +3 Query: 225 EKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIY 386 E+ KEV + + +TP +++++ V+ S+ARR L L E+G++ ++ +Y Sbjct: 36 EQARKEVARERWVTPHKLAQKMGVKVSIARRVLRILEEEGVLVLFTRNRRSPLY 89 >UniRef50_A2BLT6 Cluster: 30S ribosomal protein S25e; n=1; Hyperthermus butylicus DSM 5456|Rep: 30S ribosomal protein S25e - Hyperthermus butylicus (strain DSM 5456 / JCM 9403) Length = 76 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/44 (29%), Positives = 30/44 (68%) Frame = +3 Query: 222 YEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIELREKGLIK 353 Y+++ +EV + +TP +++E+ + SLAR+ L L ++G+++ Sbjct: 18 YKRIAREVKRESFVTPYMLAEKYNMTISLARQVLKRLAKEGIVE 61 >UniRef50_Q80XE3 Cluster: BC051076 protein; n=3; Murinae|Rep: BC051076 protein - Mus musculus (Mouse) Length = 452 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 65 PPKKDAKASAKQPQKTQKKKEGSRWRQSQEEEVVQRK 175 P +K A + AKQP K++K++ R +Q +EE ++RK Sbjct: 25 PKRKQASSRAKQPPKSRKERRQQR-KQQREESRLERK 60 >UniRef50_Q1YII8 Cluster: Possible regulatory protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Possible regulatory protein - Aurantimonas sp. SI85-9A1 Length = 344 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = +3 Query: 243 VPQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQV 359 +P +T ++++ERL + + RRAL EL ++GL+K+V Sbjct: 41 LPALGHLTESLLAERLGISRAPVRRALSELEQQGLVKRV 79 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,840,337 Number of Sequences: 1657284 Number of extensions: 12933553 Number of successful extensions: 48458 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 40098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47568 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81161904978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -