BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G03 (896 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera... 128 1e-28 UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re... 95 3e-18 UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Re... 64 5e-09 UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera... 49 1e-04 UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor... 49 2e-04 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 45 0.003 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 45 0.003 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 45 0.003 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 45 0.003 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 45 0.003 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 45 0.003 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 44 0.004 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 44 0.005 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 44 0.005 UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep... 42 0.016 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 42 0.021 UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecro... 42 0.021 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 42 0.028 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 42 0.028 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 42 0.028 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 42 0.028 UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|R... 42 0.028 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 41 0.037 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 41 0.037 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 41 0.049 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 41 0.049 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 41 0.049 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 41 0.049 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 41 0.049 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 41 0.049 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 41 0.049 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 40 0.065 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 40 0.065 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 40 0.065 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 40 0.065 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 40 0.086 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 40 0.086 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 40 0.086 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 40 0.11 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 40 0.11 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 40 0.11 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 40 0.11 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 40 0.11 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 39 0.15 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 39 0.15 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 39 0.15 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 39 0.15 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 39 0.15 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 39 0.15 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 39 0.15 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 39 0.15 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 39 0.15 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 39 0.20 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 39 0.20 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 39 0.20 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 39 0.20 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 39 0.20 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 39 0.20 UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyce... 39 0.20 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 38 0.26 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 38 0.26 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 38 0.26 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 38 0.26 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 38 0.26 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 38 0.26 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.26 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.26 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 38 0.26 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 38 0.26 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 38 0.26 UniRef50_Q4SIS2 Cluster: Chromosome 21 SCAF14577, whole genome s... 38 0.35 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 38 0.35 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 38 0.35 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 38 0.35 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 38 0.35 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 38 0.35 UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis... 38 0.35 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 38 0.35 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 38 0.46 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 38 0.46 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 38 0.46 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 38 0.46 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 38 0.46 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.46 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 38 0.46 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 38 0.46 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 38 0.46 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.46 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 38 0.46 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 38 0.46 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 37 0.61 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 37 0.61 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 37 0.61 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 37 0.61 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 37 0.61 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 37 0.61 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 37 0.61 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 37 0.61 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 37 0.61 UniRef50_Q6BI43 Cluster: Similar to CA6126|IPF143 Candida albica... 37 0.61 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 37 0.61 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 37 0.61 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 37 0.61 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 37 0.61 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 37 0.61 UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein;... 37 0.80 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 37 0.80 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 37 0.80 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 37 0.80 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 37 0.80 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 37 0.80 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 37 0.80 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 37 0.80 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 37 0.80 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 37 0.80 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 36 1.1 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 36 1.1 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 36 1.1 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 36 1.1 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 36 1.1 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 36 1.1 UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precur... 36 1.1 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.1 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 36 1.1 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.1 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.1 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 36 1.1 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 36 1.1 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 36 1.1 UniRef50_Q8ZSX8 Cluster: Putative uncharacterized protein PAE353... 36 1.1 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 36 1.4 UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 36 1.4 UniRef50_A1ULP9 Cluster: Transglycosylase domain protein precurs... 36 1.4 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 36 1.4 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 36 1.4 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.4 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 36 1.4 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 36 1.4 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 36 1.4 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 36 1.4 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 36 1.4 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 36 1.4 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 36 1.4 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 36 1.4 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 36 1.9 UniRef50_Q66J90 Cluster: MGC81602 protein; n=3; Xenopus|Rep: MGC... 36 1.9 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 36 1.9 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 36 1.9 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 36 1.9 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 36 1.9 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 36 1.9 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 36 1.9 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 36 1.9 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 36 1.9 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 36 1.9 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 36 1.9 UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium glob... 36 1.9 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 36 1.9 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 36 1.9 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 36 1.9 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 36 1.9 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 35 2.4 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 35 2.4 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 35 2.4 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 35 2.4 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 35 2.4 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 35 2.4 UniRef50_A3Q834 Cluster: Putative uncharacterized protein precur... 35 2.4 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 35 2.4 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 35 2.4 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 35 2.4 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 35 2.4 UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster... 35 2.4 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 35 2.4 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 35 2.4 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 35 2.4 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 35 2.4 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 35 2.4 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 35 2.4 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 35 2.4 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.4 UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomo... 35 2.4 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 35 2.4 UniRef50_Q0U3V3 Cluster: Putative uncharacterized protein; n=1; ... 35 2.4 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 35 2.4 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 35 2.4 UniRef50_UPI0000E494ED Cluster: PREDICTED: similar to FIP1 like ... 35 3.2 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 35 3.2 UniRef50_UPI00006A1337 Cluster: Histone-lysine N-methyltransfera... 35 3.2 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 35 3.2 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 35 3.2 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 35 3.2 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 35 3.2 UniRef50_Q8S9B5 Cluster: Matrix metalloproteinase; n=1; Volvox c... 35 3.2 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 35 3.2 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 35 3.2 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 35 3.2 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 35 3.2 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 35 3.2 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 35 3.2 UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=... 35 3.2 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 35 3.2 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 35 3.2 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 35 3.2 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 35 3.2 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 35 3.2 UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin ... 35 3.2 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 35 3.2 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 35 3.2 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 35 3.2 UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein;... 34 4.3 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 34 4.3 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 34 4.3 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 34 4.3 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 34 4.3 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 34 4.3 UniRef50_Q6NWB3 Cluster: Splicing factor 3b, subunit 4; n=16; Eu... 34 4.3 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 34 4.3 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 34 4.3 UniRef50_Q3E7G7 Cluster: Uncharacterized protein At5g19090.2; n=... 34 4.3 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 34 4.3 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 34 4.3 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 34 4.3 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_A5AEG8 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 34 4.3 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 34 4.3 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 34 4.3 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 34 4.3 UniRef50_Q19079 Cluster: Dumpy : shorter than wild-type protein ... 34 4.3 UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, wh... 34 4.3 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 34 4.3 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 34 4.3 UniRef50_Q2U6G9 Cluster: Predicted protein; n=5; Trichocomaceae|... 34 4.3 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 34 4.3 UniRef50_Q8ZU13 Cluster: Putative uncharacterized protein PAE299... 34 4.3 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 34 4.3 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 34 4.3 UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP000... 34 5.7 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 34 5.7 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 34 5.7 UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein;... 34 5.7 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 34 5.7 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 34 5.7 UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus ... 34 5.7 UniRef50_Q2W1I3 Cluster: Submaxillary gland androgen regulated p... 34 5.7 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 34 5.7 UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: Hr... 34 5.7 UniRef50_Q1YK84 Cluster: Putative uncharacterized protein; n=1; ... 34 5.7 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 34 5.7 UniRef50_A7INX6 Cluster: Putative head morphogenesis protein SPP... 34 5.7 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 34 5.7 UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin ... 34 5.7 UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structu... 34 5.7 UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Ory... 34 5.7 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 34 5.7 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 34 5.7 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 34 5.7 UniRef50_A2FGM2 Cluster: PH domain containing protein; n=1; Tric... 34 5.7 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 34 5.7 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 34 5.7 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 34 5.7 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 34 5.7 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 34 5.7 UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; ... 34 5.7 UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina... 34 5.7 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.7 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 34 5.7 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 33 7.5 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 33 7.5 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 33 7.5 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 33 7.5 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 33 7.5 UniRef50_Q4A2G4 Cluster: Putative membrane protein precursor; n=... 33 7.5 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 33 7.5 UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaen... 33 7.5 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 33 7.5 UniRef50_A2SM82 Cluster: Periplasmic protein/ biopolymer transpo... 33 7.5 UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thalian... 33 7.5 UniRef50_Q6QNA3 Cluster: Proline-rich protein 1; n=2; Solanaceae... 33 7.5 UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: T... 33 7.5 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 33 7.5 UniRef50_Q01JG9 Cluster: H0818E04.14 protein; n=7; Oryza sativa|... 33 7.5 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 33 7.5 UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n... 33 7.5 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 33 7.5 UniRef50_A2XNT5 Cluster: Putative uncharacterized protein; n=7; ... 33 7.5 UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21... 33 7.5 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 33 7.5 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 33 7.5 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 33 7.5 UniRef50_A1DF14 Cluster: Cell wall protein, putative; n=2; Trich... 33 7.5 UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovir... 33 7.5 UniRef50_Q15428 Cluster: Splicing factor 3A subunit 2; n=69; Euk... 33 7.5 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 33 7.5 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 33 7.5 UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70;... 33 7.5 UniRef50_P10323 Cluster: Acrosin precursor (EC 3.4.21.10) [Conta... 33 7.5 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 33 9.9 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 33 9.9 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 33 9.9 UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein;... 33 9.9 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 33 9.9 UniRef50_UPI000066086F Cluster: Homolog of Gallus gallus "Diapha... 33 9.9 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 33 9.9 UniRef50_Q4S026 Cluster: Chromosome 21 SCAF14785, whole genome s... 33 9.9 UniRef50_Q1L903 Cluster: Novel protein similar to vertebrate for... 33 9.9 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 33 9.9 UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary... 33 9.9 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 33 9.9 UniRef50_Q3R5V3 Cluster: Putative uncharacterized protein precur... 33 9.9 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 33 9.9 UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; ... 33 9.9 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 33 9.9 UniRef50_A0R4R5 Cluster: Putative secreted protein; n=1; Mycobac... 33 9.9 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 33 9.9 UniRef50_Q9FW12 Cluster: Putative proteophosphoglycan; n=1; Oryz... 33 9.9 UniRef50_Q9FGY2 Cluster: Dbj|BAA84609.1; n=2; Arabidopsis thalia... 33 9.9 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 33 9.9 UniRef50_Q7XCX5 Cluster: Plus-3 domain containing protein, expre... 33 9.9 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 33 9.9 UniRef50_Q39005 Cluster: Cell wall protein precursor; n=3; Arabi... 33 9.9 UniRef50_Q2RAC3 Cluster: Harpin-induced protein 1 containing pro... 33 9.9 UniRef50_Q2QR52 Cluster: Transposon protein, putative, CACTA, En... 33 9.9 UniRef50_Q0J2H9 Cluster: Os09g0341100 protein; n=8; Oryza sativa... 33 9.9 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 33 9.9 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 33 9.9 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 33 9.9 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 33 9.9 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 33 9.9 UniRef50_A7SEJ5 Cluster: Predicted protein; n=2; Nematostella ve... 33 9.9 UniRef50_A7RV64 Cluster: Predicted protein; n=2; Nematostella ve... 33 9.9 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 33 9.9 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 33 9.9 UniRef50_Q9P6R1 Cluster: Verprolin; n=2; Eukaryota|Rep: Verproli... 33 9.9 UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora cras... 33 9.9 UniRef50_Q2H2Z3 Cluster: Predicted protein; n=1; Chaetomium glob... 33 9.9 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 33 9.9 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 33 9.9 UniRef50_Q9UPN6 Cluster: Putative RNA-binding protein 16; n=35; ... 33 9.9 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 33 9.9 UniRef50_P27483 Cluster: Glycine-rich cell wall structural prote... 33 9.9 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 33 9.9 >UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera|Rep: Cecropin-B precursor - Bombyx mori (Silk moth) Length = 63 Score = 128 bits (310), Expect = 1e-28 Identities = 63/63 (100%), Positives = 63/63 (100%) Frame = +1 Query: 133 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 312 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA Sbjct: 1 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 60 Query: 313 IGK 321 IGK Sbjct: 61 IGK 63 >UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep: Cecropin-A precursor - Hyalophora cecropia (Cecropia moth) Length = 64 Score = 94.7 bits (225), Expect = 3e-18 Identities = 41/63 (65%), Positives = 53/63 (84%) Frame = +1 Query: 133 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 312 MNF++I FVFA + AL+M +AAPEP+WK+FKKIEK+G+NIRDGI+KAGPA+ V+G A Sbjct: 1 MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQ 60 Query: 313 IGK 321 I K Sbjct: 61 IAK 63 >UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Rep: Cecropin A - Plutella xylostella (Diamondback moth) Length = 66 Score = 64.1 bits (149), Expect = 5e-09 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 133 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVK-AGPAIEVLGSAK 309 M + I FVF A++ SAAP RWK FKK+EK+GRNIR+GI++ GPA+ V+G A Sbjct: 1 MKLSNIFFFVFMAFFAVASVSAAP--RWKPFKKLEKVGRNIRNGIIRYNGPAVAVIGQAT 58 Query: 310 AIGK 321 +I + Sbjct: 59 SIAR 62 >UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera|Rep: Antibacterial peptide - Bombyx mori (Silk moth) Length = 66 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/61 (40%), Positives = 37/61 (60%) Frame = +1 Query: 133 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 312 M F KI VF ++ + + S A W FK++E +G+ +RD I+ AGPAI+VL AK Sbjct: 1 MYFTKI---VFVAIICIMIVSCASA--WDFFKELEGVGQRVRDSIISAGPAIDVLQKAKG 55 Query: 313 I 315 + Sbjct: 56 L 56 >UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor; n=5; Ditrysia|Rep: Antibacterial peptide enbocin precursor - Bombyx mori (Silk moth) Length = 59 Score = 48.8 bits (111), Expect = 2e-04 Identities = 23/61 (37%), Positives = 39/61 (63%) Frame = +1 Query: 133 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 312 MNF +I+ F+F +V A +A+ +P W IFK+IE+ RD ++ AGPA+ + +A + Sbjct: 1 MNFTRIIFFLFVVVFA----TASGKP-WNIFKEIERAVARTRDAVISAGPAVRTVAAATS 55 Query: 313 I 315 + Sbjct: 56 V 56 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 267 PPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPP 298 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 637 PPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PPPPP GG P PP PPP P Sbjct: 257 PPPPPMMGGAPPPPPPPPGPGGAPPPPPP 285 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P P PP P P P Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Query: 809 XXXXXPP 829 PP Sbjct: 712 LVPALPP 718 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Query: 809 XXXXXPP 829 PP Sbjct: 291 PPPPPPP 297 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Query: 809 XXXXXPP 829 PP Sbjct: 296 PPPPPPP 302 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Query: 809 XXXXXPP 829 PP Sbjct: 298 PPPPPPP 304 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Query: 809 XXXXXPP 829 PP Sbjct: 299 PPPPPPP 305 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Query: 809 XXXXXPP 829 PP Sbjct: 301 PPPPPPP 307 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Query: 809 XXXXXPP 829 PP Sbjct: 302 PPPPPPP 308 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Query: 809 XXXXXPP 829 PP Sbjct: 303 PPPPPPP 309 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Query: 809 XXXXXPP 829 PP Sbjct: 304 PPPPPPP 310 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Query: 809 XXXXXPP 829 PP Sbjct: 305 PPPPPPP 311 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Query: 809 XXXXXPP 829 PP Sbjct: 306 PPPPPPP 312 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Query: 809 XXXXXPP 829 PP Sbjct: 307 PPPPPPP 313 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Query: 809 XXXXXPP 829 PP Sbjct: 308 PPPPPPP 314 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Query: 809 XXXXXPP 829 PP Sbjct: 309 PPPPPPP 315 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Query: 809 XXXXXPP 829 PP Sbjct: 310 PPPPPPP 316 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Query: 809 XXXXXPP 829 PP Sbjct: 311 PPPPPPP 317 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Query: 809 XXXXXPP 829 PP Sbjct: 312 PPPPPPP 318 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Query: 809 XXXXXPP 829 PP Sbjct: 313 PPPPPPP 319 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Query: 809 XXXXXPP 829 PP Sbjct: 314 PPPPPPP 320 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Query: 809 XXXXXPP 829 PP Sbjct: 315 PPPPPPP 321 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Query: 809 XXXXXPP 829 PP Sbjct: 316 PPPPPPP 322 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Query: 809 XXXXXPP 829 PP Sbjct: 317 PPPPPPP 323 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Query: 809 XXXXXPP 829 PP Sbjct: 318 PPPPPPP 324 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Query: 809 XXXXXPP 829 PP Sbjct: 319 PPPPPPP 325 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Query: 809 XXXXXPP 829 PP Sbjct: 320 PPPPPPP 326 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Query: 809 XXXXXPP 829 PP Sbjct: 321 PPPPPPP 327 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Query: 809 XXXXXPP 829 PP Sbjct: 322 PPPPPPP 328 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Query: 809 XXXXXPP 829 PP Sbjct: 323 PPPPPPP 329 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Query: 809 XXXXXPP 829 PP Sbjct: 324 PPPPPPP 330 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Query: 809 XXXXXPP 829 PP Sbjct: 325 PPPPPPP 331 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Query: 809 XXXXXPP 829 PP Sbjct: 326 PPPPPPP 332 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Query: 809 XXXXXPP 829 PP Sbjct: 327 PPPPPPP 333 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Query: 809 XXXXXPP 829 PP Sbjct: 328 PPPPPPP 334 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Query: 809 XXXXXPP 829 PP Sbjct: 329 PPPPPPP 335 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Query: 809 XXXXXPP 829 PP Sbjct: 330 PPPPPPP 336 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Query: 809 XXXXXPP 829 PP Sbjct: 331 PPPPPPP 337 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Query: 809 XXXXXPP 829 PP Sbjct: 332 PPPPPPP 338 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Query: 809 XXXXXPP 829 PP Sbjct: 333 PPPPPPP 339 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Query: 809 XXXXXPP 829 PP Sbjct: 334 PPPPPPP 340 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Query: 809 XXXXXPP 829 PP Sbjct: 335 PPPPPPP 341 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Query: 809 XXXXXPP 829 PP Sbjct: 336 PPPPPPP 342 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Query: 809 XXXXXPP 829 PP Sbjct: 337 PPPPPPP 343 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Query: 809 XXXXXPP 829 PP Sbjct: 338 PPPPPPP 344 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Query: 809 XXXXXPP 829 PP Sbjct: 339 PPPPPPP 345 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Query: 809 XXXXXPP 829 PP Sbjct: 340 PPPPPPP 346 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Query: 809 XXXXXPP 829 PP Sbjct: 341 PPPPPPP 347 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Query: 809 XXXXXPP 829 PP Sbjct: 342 PPPPPPP 348 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Query: 809 XXXXXPP 829 PP Sbjct: 343 PPPPPPP 349 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Query: 809 XXXXXPP 829 PP Sbjct: 344 PPPPPPP 350 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Query: 809 XXXXXPP 829 PP Sbjct: 345 PPPPPPP 351 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Query: 809 XXXXXPP 829 PP Sbjct: 346 PPPPPPP 352 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Query: 809 XXXXXPP 829 PP Sbjct: 347 PPPPPPP 353 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Query: 809 XXXXXPP 829 PP Sbjct: 348 PPPPPPP 354 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Query: 809 XXXXXPP 829 PP Sbjct: 349 PPPPPPP 355 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Query: 809 XXXXXPP 829 PP Sbjct: 350 PPPPPPP 356 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Query: 809 XXXXXPP 829 PP Sbjct: 351 PPPPPPP 357 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Query: 809 XXXXXPP 829 PP Sbjct: 352 PPPPPPP 358 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Query: 809 XXXXXPP 829 PP Sbjct: 353 PPPPPPP 359 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Query: 809 XXXXXPP 829 PP Sbjct: 354 PPPPPPP 360 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Query: 809 XXXXXPP 829 PP Sbjct: 355 PPPPPPP 361 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Query: 809 XXXXXPP 829 PP Sbjct: 356 PPPPPPP 362 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Query: 809 XXXXXPP 829 PP Sbjct: 357 PPPPPPP 363 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Query: 809 XXXXXPP 829 PP Sbjct: 358 PPPPPPP 364 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Query: 809 XXXXXPP 829 PP Sbjct: 359 PPPPPPP 365 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Query: 809 XXXXXPP 829 PP Sbjct: 360 PPPPPPP 366 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Query: 809 XXXXXPP 829 PP Sbjct: 361 PPPPPPP 367 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Query: 809 XXXXXPP 829 PP Sbjct: 362 PPPPPPP 368 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Query: 809 XXXXXPP 829 PP Sbjct: 363 PPPPPPP 369 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Query: 809 XXXXXPP 829 PP Sbjct: 364 PPPPPPP 370 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Query: 809 XXXXXPP 829 PP Sbjct: 365 PPPPPPP 371 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Query: 809 XXXXXPP 829 PP Sbjct: 366 PPPPPPP 372 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Query: 809 XXXXXPP 829 PP Sbjct: 367 PPPPPPP 373 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Query: 809 XXXXXPP 829 PP Sbjct: 368 PPPPPPP 374 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Query: 809 XXXXXPP 829 PP Sbjct: 369 PPPPPPP 375 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Query: 809 XXXXXPP 829 PP Sbjct: 370 PPPPPPP 376 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Query: 809 XXXXXPP 829 PP Sbjct: 371 PPPPPPP 377 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Query: 809 XXXXXPP 829 PP Sbjct: 372 PPPPPPP 378 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Query: 809 XXXXXPP 829 PP Sbjct: 373 PPPPPPP 379 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Query: 809 XXXXXPP 829 PP Sbjct: 374 PPPPPPP 380 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Query: 809 XXXXXPP 829 PP Sbjct: 375 PPPPPPP 381 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Query: 809 XXXXXPP 829 PP Sbjct: 376 PPPPPPP 382 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Query: 809 XXXXXPP 829 PP Sbjct: 377 PPPPPPP 383 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Query: 809 XXXXXPP 829 PP Sbjct: 378 PPPPPPP 384 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Query: 809 XXXXXPP 829 PP Sbjct: 379 PPPPPPP 385 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Query: 809 XXXXXPP 829 PP Sbjct: 380 PPPPPPP 386 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Query: 809 XXXXXPP 829 PP Sbjct: 381 PPPPPPP 387 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Query: 809 XXXXXPP 829 PP Sbjct: 382 PPPPPPP 388 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Query: 809 XXXXXPP 829 PP Sbjct: 383 PPPPPPP 389 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Query: 809 XXXXXPP 829 PP Sbjct: 384 PPPPPPP 390 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Query: 809 XXXXXPP 829 PP Sbjct: 385 PPPPPPP 391 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Query: 809 XXXXXPP 829 PP Sbjct: 386 PPPPPPP 392 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Query: 809 XXXXXPP 829 PP Sbjct: 387 PPPPPPP 393 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Query: 809 XXXXXPP 829 PP Sbjct: 388 PPPPPPP 394 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Query: 809 XXXXXPP 829 PP Sbjct: 389 PPPPPPP 395 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Query: 809 XXXXXPP 829 PP Sbjct: 390 PPPPPPP 396 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Query: 809 XXXXXPP 829 PP Sbjct: 391 PPPPPPP 397 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Query: 809 XXXXXPP 829 PP Sbjct: 392 PPPPPPP 398 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Query: 809 XXXXXPP 829 PP Sbjct: 393 PPPPPPP 399 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Query: 809 XXXXXPP 829 PP Sbjct: 394 PPPPPPP 400 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Query: 809 XXXXXPP 829 PP Sbjct: 395 PPPPPPP 401 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Query: 809 XXXXXPP 829 PP Sbjct: 396 PPPPPPP 402 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Query: 809 XXXXXPP 829 PP Sbjct: 397 PPPPPPP 403 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Query: 809 XXXXXPP 829 PP Sbjct: 398 PPPPPPP 404 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Query: 809 XXXXXPP 829 PP Sbjct: 399 PPPPPPP 405 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Query: 809 XXXXXPP 829 PP Sbjct: 400 PPPPPPP 406 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Query: 809 XXXXXPP 829 PP Sbjct: 401 PPPPPPP 407 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Query: 809 XXXXXPP 829 PP Sbjct: 402 PPPPPPP 408 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Query: 809 XXXXXPP 829 PP Sbjct: 403 PPPPPPP 409 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Query: 809 XXXXXPP 829 PP Sbjct: 404 PPPPPPP 410 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Query: 809 XXXXXPP 829 PP Sbjct: 405 PPPPPPP 411 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Query: 809 XXXXXPP 829 PP Sbjct: 406 PPPPPPP 412 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Query: 809 XXXXXPP 829 PP Sbjct: 407 PPPPPPP 413 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Query: 809 XXXXXPP 829 PP Sbjct: 408 PPPPPPP 414 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Query: 809 XXXXXPP 829 PP Sbjct: 409 PPPPPPP 415 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Query: 809 XXXXXPP 829 PP Sbjct: 410 PPPPPPP 416 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Query: 809 XXXXXPP 829 PP Sbjct: 411 PPPPPPP 417 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Query: 809 XXXXXPP 829 PP Sbjct: 412 PPPPPPP 418 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Query: 809 XXXXXPP 829 PP Sbjct: 413 PPPPPPP 419 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Query: 809 XXXXXPP 829 PP Sbjct: 414 PPPPPPP 420 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Query: 809 XXXXXPP 829 PP Sbjct: 415 PPPPPPP 421 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Query: 809 XXXXXPP 829 PP Sbjct: 416 PPPPPPP 422 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Query: 809 XXXXXPP 829 PP Sbjct: 417 PPPPPPP 423 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Query: 809 XXXXXPP 829 PP Sbjct: 418 PPPPPPP 424 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Query: 809 XXXXXPP 829 PP Sbjct: 419 PPPPPPP 425 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Query: 809 XXXXXPP 829 PP Sbjct: 420 PPPPPPP 426 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Query: 809 XXXXXPP 829 PP Sbjct: 421 PPPPPPP 427 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Query: 809 XXXXXPP 829 PP Sbjct: 422 PPPPPPP 428 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Query: 809 XXXXXPP 829 PP Sbjct: 423 PPPPPPP 429 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Query: 809 XXXXXPP 829 PP Sbjct: 424 PPPPPPP 430 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Query: 809 XXXXXPP 829 PP Sbjct: 425 PPPPPPP 431 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Query: 809 XXXXXPP 829 PP Sbjct: 426 PPPPPPP 432 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Query: 809 XXXXXPP 829 PP Sbjct: 427 PPPPPPP 433 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Query: 809 XXXXXPP 829 PP Sbjct: 428 PPPPPPP 434 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Query: 809 XXXXXPP 829 PP Sbjct: 429 PPPPPPP 435 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Query: 809 XXXXXPP 829 PP Sbjct: 430 PPPPPPP 436 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Query: 809 XXXXXPP 829 PP Sbjct: 431 PPPPPPP 437 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Query: 809 XXXXXPP 829 PP Sbjct: 432 PPPPPPP 438 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Query: 809 XXXXXPP 829 PP Sbjct: 433 PPPPPPP 439 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Query: 809 XXXXXPP 829 PP Sbjct: 434 PPPPPPP 440 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Query: 809 XXXXXPP 829 PP Sbjct: 435 PPPPPPP 441 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Query: 809 XXXXXPP 829 PP Sbjct: 436 PPPPPPP 442 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Query: 809 XXXXXPP 829 PP Sbjct: 437 PPPPPPP 443 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Query: 809 XXXXXPP 829 PP Sbjct: 438 PPPPPPP 444 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Query: 809 XXXXXPP 829 PP Sbjct: 439 PPPPPPP 445 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Query: 809 XXXXXPP 829 PP Sbjct: 440 PPPPPPP 446 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Query: 809 XXXXXPP 829 PP Sbjct: 441 PPPPPPP 447 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Query: 809 XXXXXPP 829 PP Sbjct: 442 PPPPPPP 448 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Query: 809 XXXXXPP 829 PP Sbjct: 443 PPPPPPP 449 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Query: 809 XXXXXPP 829 PP Sbjct: 444 PPPPPPP 450 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Query: 809 XXXXXPP 829 PP Sbjct: 445 PPPPPPP 451 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Query: 809 XXXXXPP 829 PP Sbjct: 446 PPPPPPP 452 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Query: 809 XXXXXPP 829 PP Sbjct: 447 PPPPPPP 453 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Query: 809 XXXXXPP 829 PP Sbjct: 448 PPPPPPP 454 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Query: 809 XXXXXPP 829 PP Sbjct: 449 PPPPPPP 455 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Query: 809 XXXXXPP 829 PP Sbjct: 450 PPPPPPP 456 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Query: 809 XXXXXPP 829 PP Sbjct: 451 PPPPPPP 457 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Query: 809 XXXXXPP 829 PP Sbjct: 452 PPPPPPP 458 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Query: 809 XXXXXPP 829 PP Sbjct: 453 PPPPPPP 459 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Query: 809 XXXXXPP 829 PP Sbjct: 454 PPPPPPP 460 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Query: 809 XXXXXPP 829 PP Sbjct: 455 PPPPPPP 461 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Query: 809 XXXXXPP 829 PP Sbjct: 456 PPPPPPP 462 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Query: 809 XXXXXPP 829 PP Sbjct: 457 PPPPPPP 463 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Query: 809 XXXXXPP 829 PP Sbjct: 458 PPPPPPP 464 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Query: 809 XXXXXPP 829 PP Sbjct: 459 PPPPPPP 465 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Query: 809 XXXXXPP 829 PP Sbjct: 460 PPPPPPP 466 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Query: 809 XXXXXPP 829 PP Sbjct: 461 PPPPPPP 467 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Query: 809 XXXXXPP 829 PP Sbjct: 462 PPPPPPP 468 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Query: 809 XXXXXPP 829 PP Sbjct: 463 PPPPPPP 469 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Query: 809 XXXXXPP 829 PP Sbjct: 464 PPPPPPP 470 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Query: 809 XXXXXPP 829 PP Sbjct: 465 PPPPPPP 471 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Query: 809 XXXXXPP 829 PP Sbjct: 466 PPPPPPP 472 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Query: 809 XXXXXPP 829 PP Sbjct: 467 PPPPPPP 473 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Query: 809 XXXXXPP 829 PP Sbjct: 468 PPPPPPP 474 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Query: 809 XXXXXPP 829 PP Sbjct: 469 PPPPPPP 475 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Query: 809 XXXXXPP 829 PP Sbjct: 470 PPPPPPP 476 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Query: 809 XXXXXPP 829 PP Sbjct: 471 PPPPPPP 477 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Query: 809 XXXXXPP 829 PP Sbjct: 472 PPPPPPP 478 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Query: 809 XXXXXPP 829 PP Sbjct: 473 PPPPPPP 479 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Query: 809 XXXXXPP 829 PP Sbjct: 474 PPPPPPP 480 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Query: 809 XXXXXPP 829 PP Sbjct: 475 PPPPPPP 481 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Query: 809 XXXXXPP 829 PP Sbjct: 476 PPPPPPP 482 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Query: 809 XXXXXPP 829 PP Sbjct: 477 PPPPPPP 483 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Query: 809 XXXXXPP 829 PP Sbjct: 478 PPPPPPP 484 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Query: 809 XXXXXPP 829 PP Sbjct: 479 PPPPPPP 485 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Query: 809 XXXXXPP 829 PP Sbjct: 480 PPPPPPP 486 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Query: 809 XXXXXPP 829 PP Sbjct: 481 PPPPPPP 487 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Query: 809 XXXXXPP 829 PP Sbjct: 482 PPPPPPP 488 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Query: 809 XXXXXPP 829 PP Sbjct: 483 PPPPPPP 489 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Query: 809 XXXXXPP 829 PP Sbjct: 484 PPPPPPP 490 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Query: 809 XXXXXPP 829 PP Sbjct: 485 PPPPPPP 491 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Query: 809 XXXXXPP 829 PP Sbjct: 486 PPPPPPP 492 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Query: 809 XXXXXPP 829 PP Sbjct: 487 PPPPPPP 493 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Query: 809 XXXXXPP 829 PP Sbjct: 488 PPPPPPP 494 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Query: 809 XXXXXPP 829 PP Sbjct: 489 PPPPPPP 495 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Query: 809 XXXXXPP 829 PP Sbjct: 490 PPPPPPP 496 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Query: 809 XXXXXPP 829 PP Sbjct: 491 PPPPPPP 497 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Query: 809 XXXXXPP 829 PP Sbjct: 492 PPPPPPP 498 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Query: 809 XXXXXPP 829 PP Sbjct: 493 PPPPPPP 499 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Query: 809 XXXXXPP 829 PP Sbjct: 494 PPPPPPP 500 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Query: 809 XXXXXPP 829 PP Sbjct: 495 PPPPPPP 501 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Query: 809 XXXXXPP 829 PP Sbjct: 496 PPPPPPP 502 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Query: 809 XXXXXPP 829 PP Sbjct: 497 PPPPPPP 503 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Query: 809 XXXXXPP 829 PP Sbjct: 498 PPPPPPP 504 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Query: 809 XXXXXPP 829 PP Sbjct: 499 PPPPPPP 505 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Query: 809 XXXXXPP 829 PP Sbjct: 500 PPPPPPP 506 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Query: 809 XXXXXPP 829 PP Sbjct: 501 PPPPPPP 507 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Query: 809 XXXXXPP 829 PP Sbjct: 502 PPPPPPP 508 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Query: 809 XXXXXPP 829 PP Sbjct: 503 PPPPPPP 509 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Query: 809 XXXXXPP 829 PP Sbjct: 504 PPPPPPP 510 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Query: 809 XXXXXPP 829 PP Sbjct: 505 PPPPPPP 511 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Query: 809 XXXXXPP 829 PP Sbjct: 506 PPPPPPP 512 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Query: 809 XXXXXPP 829 PP Sbjct: 507 PPPPPPP 513 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Query: 809 XXXXXPP 829 PP Sbjct: 508 PPPPPPP 514 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Query: 809 XXXXXPP 829 PP Sbjct: 509 PPPPPPP 515 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Query: 809 XXXXXPP 829 PP Sbjct: 510 PPPPPPP 516 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Query: 809 XXXXXPP 829 PP Sbjct: 511 PPPPPPP 517 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Query: 809 XXXXXPP 829 PP Sbjct: 512 PPPPPPP 518 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Query: 809 XXXXXPP 829 PP Sbjct: 513 PPPPPPP 519 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Query: 809 XXXXXPP 829 PP Sbjct: 514 PPPPPPP 520 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Query: 809 XXXXXPP 829 PP Sbjct: 515 PPPPPPP 521 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Query: 809 XXXXXPP 829 PP Sbjct: 516 PPPPPPP 522 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Query: 809 XXXXXPP 829 PP Sbjct: 517 PPPPPPP 523 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Query: 809 XXXXXPP 829 PP Sbjct: 518 PPPPPPP 524 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Query: 809 XXXXXPP 829 PP Sbjct: 519 PPPPPPP 525 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Query: 809 XXXXXPP 829 PP Sbjct: 520 PPPPPPP 526 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Query: 809 XXXXXPP 829 PP Sbjct: 521 PPPPPPP 527 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Query: 809 XXXXXPP 829 PP Sbjct: 522 PPPPPPP 528 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Query: 809 XXXXXPP 829 PP Sbjct: 523 PPPPPPP 529 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Query: 809 XXXXXPP 829 PP Sbjct: 524 PPPPPPP 530 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Query: 809 XXXXXPP 829 PP Sbjct: 525 PPPPPPP 531 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Query: 809 XXXXXPP 829 PP Sbjct: 526 PPPPPPP 532 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Query: 809 XXXXXPP 829 PP Sbjct: 527 PPPPPPP 533 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Query: 809 XXXXXPP 829 PP Sbjct: 528 PPPPPPP 534 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Query: 809 XXXXXPP 829 PP Sbjct: 529 PPPPPPP 535 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Query: 809 XXXXXPP 829 PP Sbjct: 530 PPPPPPP 536 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Query: 809 XXXXXPP 829 PP Sbjct: 531 PPPPPPP 537 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Query: 809 XXXXXPP 829 PP Sbjct: 532 PPPPPPP 538 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Query: 809 XXXXXPP 829 PP Sbjct: 533 PPPPPPP 539 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Query: 809 XXXXXPP 829 PP Sbjct: 534 PPPPPPP 540 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Query: 809 XXXXXPP 829 PP Sbjct: 535 PPPPPPP 541 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Query: 809 XXXXXPP 829 PP Sbjct: 536 PPPPPPP 542 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Query: 809 XXXXXPP 829 PP Sbjct: 537 PPPPPPP 543 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Query: 809 XXXXXPP 829 PP Sbjct: 538 PPPPPPP 544 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Query: 809 XXXXXPP 829 PP Sbjct: 539 PPPPPPP 545 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Query: 809 XXXXXPP 829 PP Sbjct: 540 PPPPPPP 546 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Query: 809 XXXXXPP 829 PP Sbjct: 541 PPPPPPP 547 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Query: 809 XXXXXPP 829 PP Sbjct: 542 PPPPPPP 548 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Query: 809 XXXXXPP 829 PP Sbjct: 543 PPPPPPP 549 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Query: 809 XXXXXPP 829 PP Sbjct: 544 PPPPPPP 550 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Query: 809 XXXXXPP 829 PP Sbjct: 545 PPPPPPP 551 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Query: 809 XXXXXPP 829 PP Sbjct: 546 PPPPPPP 552 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Query: 809 XXXXXPP 829 PP Sbjct: 547 PPPPPPP 553 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Query: 809 XXXXXPP 829 PP Sbjct: 548 PPPPPPP 554 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Query: 809 XXXXXPP 829 PP Sbjct: 549 PPPPPPP 555 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Query: 809 XXXXXPP 829 PP Sbjct: 550 PPPPPPP 556 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Query: 809 XXXXXPP 829 PP Sbjct: 551 PPPPPPP 557 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Query: 809 XXXXXPP 829 PP Sbjct: 552 PPPPPPP 558 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Query: 809 XXXXXPP 829 PP Sbjct: 553 PPPPPPP 559 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Query: 809 XXXXXPP 829 PP Sbjct: 554 PPPPPPP 560 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Query: 809 XXXXXPP 829 PP Sbjct: 555 PPPPPPP 561 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Query: 809 XXXXXPP 829 PP Sbjct: 556 PPPPPPP 562 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Query: 809 XXXXXPP 829 PP Sbjct: 557 PPPPPPP 563 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Query: 809 XXXXXPP 829 PP Sbjct: 558 PPPPPPP 564 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Query: 809 XXXXXPP 829 PP Sbjct: 559 PPPPPPP 565 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Query: 809 XXXXXPP 829 PP Sbjct: 560 PPPPPPP 566 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Query: 809 XXXXXPP 829 PP Sbjct: 561 PPPPPPP 567 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Query: 809 XXXXXPP 829 PP Sbjct: 562 PPPPPPP 568 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Query: 809 XXXXXPP 829 PP Sbjct: 563 PPPPPPP 569 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Query: 809 XXXXXPP 829 PP Sbjct: 564 PPPPPPP 570 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Query: 809 XXXXXPP 829 PP Sbjct: 565 PPPPPPP 571 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Query: 809 XXXXXPP 829 PP Sbjct: 566 PPPPPPP 572 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Query: 809 XXXXXPP 829 PP Sbjct: 567 PPPPPPP 573 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Query: 809 XXXXXPP 829 PP Sbjct: 568 PPPPPPP 574 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Query: 809 XXXXXPP 829 PP Sbjct: 569 PPPPPPP 575 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Query: 809 XXXXXPP 829 PP Sbjct: 570 PPPPPPP 576 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Query: 809 XXXXXPP 829 PP Sbjct: 571 PPPPPPP 577 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Query: 809 XXXXXPP 829 PP Sbjct: 572 PPPPPPP 578 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Query: 809 XXXXXPP 829 PP Sbjct: 573 PPPPPPP 579 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Query: 809 XXXXXPP 829 PP Sbjct: 574 PPPPPPP 580 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Query: 809 XXXXXPP 829 PP Sbjct: 575 PPPPPPP 581 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Query: 809 XXXXXPP 829 PP Sbjct: 576 PPPPPPP 582 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Query: 809 XXXXXPP 829 PP Sbjct: 577 PPPPPPP 583 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Query: 809 XXXXXPP 829 PP Sbjct: 578 PPPPPPP 584 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Query: 809 XXXXXPP 829 PP Sbjct: 579 PPPPPPP 585 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Query: 809 XXXXXPP 829 PP Sbjct: 580 PPPPPPP 586 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Query: 809 XXXXXPP 829 PP Sbjct: 581 PPPPPPP 587 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Query: 809 XXXXXPP 829 PP Sbjct: 582 PPPPPPP 588 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Query: 809 XXXXXPP 829 PP Sbjct: 583 PPPPPPP 589 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Query: 809 XXXXXPP 829 PP Sbjct: 584 PPPPPPP 590 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Query: 809 XXXXXPP 829 PP Sbjct: 585 PPPPPPP 591 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Query: 809 XXXXXPP 829 PP Sbjct: 586 PPPPPPP 592 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Query: 809 XXXXXPP 829 PP Sbjct: 587 PPPPPPP 593 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Query: 809 XXXXXPP 829 PP Sbjct: 588 PPPPPPP 594 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Query: 809 XXXXXPP 829 PP Sbjct: 589 PPPPPPP 595 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Query: 809 XXXXXPP 829 PP Sbjct: 590 PPPPPPP 596 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Query: 809 XXXXXPP 829 PP Sbjct: 591 PPPPPPP 597 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Query: 809 XXXXXPP 829 PP Sbjct: 592 PPPPPPP 598 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Query: 809 XXXXXPP 829 PP Sbjct: 593 PPPPPPP 599 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Query: 809 XXXXXPP 829 PP Sbjct: 594 PPPPPPP 600 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Query: 809 XXXXXPP 829 PP Sbjct: 595 PPPPPPP 601 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Query: 809 XXXXXPP 829 PP Sbjct: 596 PPPPPPP 602 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Query: 809 XXXXXPP 829 PP Sbjct: 597 PPPPPPP 603 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Query: 809 XXXXXPP 829 PP Sbjct: 598 PPPPPPP 604 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Query: 809 XXXXXPP 829 PP Sbjct: 599 PPPPPPP 605 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Query: 809 XXXXXPP 829 PP Sbjct: 600 PPPPPPP 606 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Query: 809 XXXXXPP 829 PP Sbjct: 601 PPPPPPP 607 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Query: 809 XXXXXPP 829 PP Sbjct: 602 PPPPPPP 608 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Query: 809 XXXXXPP 829 PP Sbjct: 603 PPPPPPP 609 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Query: 809 XXXXXPP 829 PP Sbjct: 604 PPPPPPP 610 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Query: 809 XXXXXPP 829 PP Sbjct: 605 PPPPPPP 611 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Query: 809 XXXXXPP 829 PP Sbjct: 606 PPPPPPP 612 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Query: 809 XXXXXPP 829 PP Sbjct: 607 PPPPPPP 613 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Query: 809 XXXXXPP 829 PP Sbjct: 608 PPPPPPP 614 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Query: 809 XXXXXPP 829 PP Sbjct: 609 PPPPPPP 615 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Query: 809 XXXXXPP 829 PP Sbjct: 610 PPPPPPP 616 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Query: 809 XXXXXPP 829 PP Sbjct: 611 PPPPPPP 617 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Query: 809 XXXXXPP 829 PP Sbjct: 612 PPPPPPP 618 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Query: 809 XXXXXPP 829 PP Sbjct: 613 PPPPPPP 619 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Query: 809 XXXXXPP 829 PP Sbjct: 614 PPPPPPP 620 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Query: 809 XXXXXPP 829 PP Sbjct: 615 PPPPPPP 621 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Query: 809 XXXXXPP 829 PP Sbjct: 616 PPPPPPP 622 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Query: 809 XXXXXPP 829 PP Sbjct: 617 PPPPPPP 623 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Query: 809 XXXXXPP 829 PP Sbjct: 618 PPPPPPP 624 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Query: 809 XXXXXPP 829 PP Sbjct: 619 PPPPPPP 625 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Query: 809 XXXXXPP 829 PP Sbjct: 620 PPPPPPP 626 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Query: 809 XXXXXPP 829 PP Sbjct: 621 PPPPPPP 627 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Query: 809 XXXXXPP 829 PP Sbjct: 622 PPPPPPP 628 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Query: 809 XXXXXPP 829 PP Sbjct: 623 PPPPPPP 629 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Query: 809 XXXXXPP 829 PP Sbjct: 624 PPPPPPP 630 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Query: 809 XXXXXPP 829 PP Sbjct: 625 PPPPPPP 631 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Query: 809 XXXXXPP 829 PP Sbjct: 626 PPPPPPP 632 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Query: 809 XXXXXPP 829 PP Sbjct: 627 PPPPPPP 633 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Query: 809 XXXXXPP 829 PP Sbjct: 628 PPPPPPP 634 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Query: 809 XXXXXPP 829 PP Sbjct: 629 PPPPPPP 635 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Query: 809 XXXXXPP 829 PP Sbjct: 630 PPPPPPP 636 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Query: 809 XXXXXPP 829 PP Sbjct: 631 PPPPPPP 637 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Query: 809 XXXXXPP 829 PP Sbjct: 632 PPPPPPP 638 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Query: 809 XXXXXPP 829 PP Sbjct: 633 PPPPPPP 639 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Query: 809 XXXXXPP 829 PP Sbjct: 634 PPPPPPP 640 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Query: 809 XXXXXPP 829 PP Sbjct: 635 PPPPPPP 641 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Query: 809 XXXXXPP 829 PP Sbjct: 636 PPPPPPP 642 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Query: 809 XXXXXPP 829 PP Sbjct: 637 PPPPPPP 643 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Query: 809 XXXXXPP 829 PP Sbjct: 638 PPPPPPP 644 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Query: 809 XXXXXPP 829 PP Sbjct: 639 PPPPPPP 645 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Query: 809 XXXXXPP 829 PP Sbjct: 640 PPPPPPP 646 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Query: 809 XXXXXPP 829 PP Sbjct: 641 PPPPPPP 647 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Query: 809 XXXXXPP 829 PP Sbjct: 642 PPPPPPP 648 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Query: 809 XXXXXPP 829 PP Sbjct: 643 PPPPPPP 649 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Query: 809 XXXXXPP 829 PP Sbjct: 644 PPPPPPP 650 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Query: 809 XXXXXPP 829 PP Sbjct: 645 PPPPPPP 651 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Query: 809 XXXXXPP 829 PP Sbjct: 646 PPPPPPP 652 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Query: 809 XXXXXPP 829 PP Sbjct: 647 PPPPPPP 653 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Query: 809 XXXXXPP 829 PP Sbjct: 648 PPPPPPP 654 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Query: 809 XXXXXPP 829 PP Sbjct: 649 PPPPPPP 655 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Query: 809 XXXXXPP 829 PP Sbjct: 650 PPPPPPP 656 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Query: 809 XXXXXPP 829 PP Sbjct: 651 PPPPPPP 657 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Query: 809 XXXXXPP 829 PP Sbjct: 652 PPPPPPP 658 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Query: 809 XXXXXPP 829 PP Sbjct: 653 PPPPPPP 659 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Query: 809 XXXXXPP 829 PP Sbjct: 654 PPPPPPP 660 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Query: 809 XXXXXPP 829 PP Sbjct: 655 PPPPPPP 661 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Query: 809 XXXXXPP 829 PP Sbjct: 656 PPPPPPP 662 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Query: 809 XXXXXPP 829 PP Sbjct: 657 PPPPPPP 663 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Query: 809 XXXXXPP 829 PP Sbjct: 658 PPPPPPP 664 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Query: 809 XXXXXPP 829 PP Sbjct: 659 PPPPPPP 665 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Query: 809 XXXXXPP 829 PP Sbjct: 660 PPPPPPP 666 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Query: 809 XXXXXPP 829 PP Sbjct: 661 PPPPPPP 667 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Query: 809 XXXXXPP 829 PP Sbjct: 662 PPPPPPP 668 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Query: 809 XXXXXPP 829 PP Sbjct: 663 PPPPPPP 669 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Query: 809 XXXXXPP 829 PP Sbjct: 664 PPPPPPP 670 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Query: 809 XXXXXPP 829 PP Sbjct: 665 PPPPPPP 671 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Query: 809 XXXXXPP 829 PP Sbjct: 666 PPPPPPP 672 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Query: 809 XXXXXPP 829 PP Sbjct: 667 PPPPPPP 673 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Query: 809 XXXXXPP 829 PP Sbjct: 668 PPPPPPP 674 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Query: 809 XXXXXPP 829 PP Sbjct: 671 PPPPLPP 677 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Query: 809 XXXXXPP 829 PP Sbjct: 674 PLPPSPP 680 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Query: 809 XXXXXPP 829 PP Sbjct: 675 LPPSPPP 681 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPL 675 Query: 809 XXXXXPP 829 PP Sbjct: 676 PPSPPPP 682 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Query: 809 XXXXXPP 829 PP Sbjct: 678 SPPPPPP 684 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678 Query: 809 XXXXXPP 829 PP Sbjct: 679 PPPPPPP 685 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Query: 809 XXXXXPP 829 PP Sbjct: 681 PPPPPPP 687 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Query: 809 XXXXXPP 829 PP Sbjct: 682 PPPPPPP 688 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Query: 809 XXXXXPP 829 PP Sbjct: 683 PPPPPPP 689 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Query: 809 XXXXXPP 829 PP Sbjct: 684 PPPPPPP 690 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Query: 809 XXXXXPP 829 PP Sbjct: 686 PPPPPPP 692 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Query: 809 XXXXXPP 829 PP Sbjct: 687 PPPPPPP 693 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Query: 809 XXXXXPP 829 PP Sbjct: 689 PPPPPPP 695 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Query: 809 XXXXXPP 829 PP Sbjct: 690 PPPPPPP 696 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Query: 809 XXXXXPP 829 PP Sbjct: 692 PPPPPPP 698 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Query: 809 XXXXXPP 829 PP Sbjct: 693 PPPPPPP 699 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Query: 809 XXXXXPP 829 PP Sbjct: 694 PPPPPPP 700 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Query: 809 XXXXXPP 829 PP Sbjct: 695 PPPPPPP 701 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Query: 809 XXXXXPP 829 PP Sbjct: 278 PPPPPPP 284 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Query: 809 XXXXXP 826 P Sbjct: 702 PHPPPP 707 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Query: 809 XXXXXPP 829 PP Sbjct: 276 PPPPPPP 282 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P P PP P P P Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Query: 809 XXXXXPP 829 PP Sbjct: 279 PPPPPPP 285 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Query: 809 XXXXXPP 829 PP Sbjct: 289 PPPPPPP 295 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP PPP P P PP P P P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Query: 809 XXXXXPP 829 PP Sbjct: 292 PPPPPPP 298 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Query: 809 XXXXXPP 829 PP Sbjct: 691 PPPPPPP 697 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Query: 809 XXXXXPP 829 PP Sbjct: 700 PPPHPPP 706 Score = 40.3 bits (90), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P P PP P P P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Query: 809 XXXXXPP 829 PP Sbjct: 287 PPPPPPP 293 Score = 40.3 bits (90), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Query: 809 XXXXXPP 829 PP Sbjct: 294 PPPPPPP 300 Score = 40.3 bits (90), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Query: 809 XXXXXPP 829 PP Sbjct: 699 PPPPHPP 705 Score = 39.9 bits (89), Expect = 0.086 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 211 PPSPPPPPPLPPSPPPP-SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Query: 809 XXXXXPP 829 PP Sbjct: 270 PPPPPPP 276 Score = 39.9 bits (89), Expect = 0.086 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 224 PPPPSPPPPPP-SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Query: 809 XXXXXPP 829 PP Sbjct: 283 PPPPPPP 289 Score = 39.9 bits (89), Expect = 0.086 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P PP P P P Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Query: 809 XXXXXPP 829 PP Sbjct: 286 PPPPPPP 292 Score = 39.9 bits (89), Expect = 0.086 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Query: 809 XXXXXPP 829 PP Sbjct: 293 PPPPPPP 299 Score = 39.9 bits (89), Expect = 0.086 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P PP P P P Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Query: 809 XXXXXPP 829 PP Sbjct: 701 PPHPPPP 707 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP--PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP PP PP PPP P P PP P P Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Query: 803 PXXXXXXPP 829 P PP Sbjct: 272 PPPPPPPPP 280 Score = 37.9 bits (84), Expect = 0.35 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 647 PPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXXP 826 PP PPPP PPP P P PP P P P P Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Query: 827 P 829 P Sbjct: 269 P 269 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP PPP P P PP P P P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Query: 809 XXXXXPP 829 PP Sbjct: 282 PPPPPPP 288 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PP P PPP P P PP P P P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Query: 809 XXXXXPP 829 PP Sbjct: 285 PPPPPPP 291 Score = 37.1 bits (82), Expect = 0.61 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PP P P PP P P P Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Query: 809 XXXXXP 826 P Sbjct: 706 PPSPPP 711 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 679 PPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPP 710 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 693 PPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPP 724 Score = 41.1 bits (92), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP GPPP P Sbjct: 665 PPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPP 696 Score = 39.5 bits (88), Expect = 0.11 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 637 PPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PPPPP GG P PP GPPP P Sbjct: 707 PPPPPPPGGGPPPPPPPPGAKAGGPPPPP 735 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P PP Sbjct: 706 PPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPP 745 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP G PP P Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPP 681 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP G P PP GPPP P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPP 682 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP GG P PP PPP P Sbjct: 666 PPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPP 697 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP G PPPP PPP P P PP Sbjct: 680 PPPPPPPMTGG-GPPPPPPPPPMTGGGPPPPPPPPGGGPP 718 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPP--XXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 717 PPPPPPPPGAKAGGPPPPP----PPFGKGPPPPP 746 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 581 PPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPP 612 Score = 41.1 bits (92), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG PP GPPP P Sbjct: 594 PPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPP 625 Score = 40.3 bits (90), Expect = 0.065 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 608 PPPPPPPPMMGGGPPPP--PPMGGKGGPPPPP 637 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 595 PPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPP 626 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPP 459 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 442 PPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPP 473 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 456 PPPPPPPPGPGGGPPPPPPPPGGGPPGPPPPP 487 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPPP PPP P P P P P Sbjct: 418 PPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPG 477 Query: 818 XXPP 829 PP Sbjct: 478 GGPP 481 Score = 37.9 bits (84), Expect = 0.35 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 416 PPPPPPPP--GGVPPPPPPPPPGMGGAPPPPP 445 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP 733 P PPP G PPPP APPP P P Sbjct: 417 PPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPP 448 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 554 PPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP G PP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPP 542 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP GPPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 35.1 bits (77), Expect = 2.4 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 7/74 (9%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP-------XKXPPXXXXXXXPXXPXX 787 P P PP G PPPP PPP P P PP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 788 XXXXXPXXXXXXPP 829 P PP Sbjct: 572 PGMMRPGGGPPPPP 585 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Query: 809 XXXXXPP 829 PP Sbjct: 388 PSPPPPP 394 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485 Query: 809 XXXXXPP 829 PP Sbjct: 486 PSPPPPP 492 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 442 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Query: 809 XXXXXPP 829 PP Sbjct: 502 PSPPPPP 508 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 291 Query: 809 XXXXXPP 829 PP Sbjct: 292 PPPPSPP 298 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 284 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Query: 809 XXXXXPP 829 PP Sbjct: 344 PSPPPPP 350 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 392 Query: 809 XXXXXPP 829 PP Sbjct: 393 PPPPSPP 399 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Query: 809 XXXXXPP 829 PP Sbjct: 478 PPPPSPP 484 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506 Query: 809 XXXXXPP 829 PP Sbjct: 507 PPPPSPP 513 Score = 42.7 bits (96), Expect = 0.012 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 270 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPS 329 Query: 809 XXXXXPP 829 PP Sbjct: 330 PPPPPPP 336 Score = 42.7 bits (96), Expect = 0.012 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Query: 809 XXXXXPP 829 PP Sbjct: 387 PPSPPPP 393 Score = 42.7 bits (96), Expect = 0.012 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430 Query: 809 XXXXXPP 829 PP Sbjct: 431 PPPPSPP 437 Score = 42.7 bits (96), Expect = 0.012 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Query: 809 XXXXXPP 829 PP Sbjct: 501 PPSPPPP 507 Score = 42.7 bits (96), Expect = 0.012 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 544 Query: 809 XXXXXPP 829 PP Sbjct: 545 PPPPSPP 551 Score = 41.9 bits (94), Expect = 0.021 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P P PP P P P Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPS 337 Query: 809 XXXXXPP 829 PP Sbjct: 338 PPPPPPP 344 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P PP P P P Sbjct: 304 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 363 Query: 809 XXXXXPP 829 PP Sbjct: 364 PPPPSPP 370 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P PP P P P Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 446 Query: 809 XXXXXPP 829 PP Sbjct: 447 PPPPSPP 453 Score = 41.5 bits (93), Expect = 0.028 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P P PP P P P Sbjct: 425 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP--PPSPPPPPPPSPPPPSPPPPSPPPPS 482 Query: 809 XXXXXPP 829 PP Sbjct: 483 PPPPSPP 489 Score = 41.5 bits (93), Expect = 0.028 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P P PP P P P Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPPP 490 Query: 809 XXXXXPP 829 PP Sbjct: 491 PPPPSPP 497 Score = 41.1 bits (92), Expect = 0.037 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P Sbjct: 372 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 431 Query: 809 XXXXXPP 829 PP Sbjct: 432 PPPSPPP 438 Score = 41.1 bits (92), Expect = 0.037 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493 Query: 809 XXXXXPP 829 PP Sbjct: 494 PSPPPPP 500 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Query: 809 XXXXXPP 829 PP Sbjct: 279 PSPPPPP 285 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PP P P PP P P P Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Query: 809 XXXXXPP 829 PP Sbjct: 287 PSPPPPP 293 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 296 Query: 809 XXXXXPP 829 PP Sbjct: 297 PPPPSPP 303 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PP P P PP P P P Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 304 Query: 809 XXXXXPP 829 PP Sbjct: 305 PSPPPPP 311 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 309 Query: 809 XXXXXPP 829 PP Sbjct: 310 PPPPSPP 316 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 314 Query: 809 XXXXXPP 829 PP Sbjct: 315 PPPPSPP 321 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Query: 809 XXXXXPP 829 PP Sbjct: 336 PSPPPPP 342 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 348 Query: 809 XXXXXPP 829 PP Sbjct: 349 PPPPSPP 355 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 294 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 353 Query: 809 XXXXXPP 829 PP Sbjct: 354 PPPPSPP 360 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 371 Query: 809 XXXXXPP 829 PP Sbjct: 372 PSPPPPP 378 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P P P P P Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 379 Query: 809 XXXXXPP 829 PP Sbjct: 380 PSPPPPP 386 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P PP P P P Sbjct: 403 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 462 Query: 809 XXXXXPP 829 PP Sbjct: 463 PPPPSPP 469 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Query: 809 XXXXXPP 829 PP Sbjct: 470 PPSPPPP 476 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP PPPP PPP P P PP P P Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322 Query: 803 PXXXXXXPP 829 P PP Sbjct: 323 PSPPPPSPP 331 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 341 PPPPSPPPPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 397 Query: 809 XXXXXPP 829 PP Sbjct: 398 PPPPSPP 404 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP PPPP PPP P P PP P P Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Query: 803 PXXXXXXPP 829 P PP Sbjct: 424 PPPSPPPPP 432 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 455 PPPPSPPPPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 511 Query: 809 XXXXXPP 829 PP Sbjct: 512 PPPPSPP 518 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP PPPP PPP P P PP P P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 Query: 803 PXXXXXXPP 829 P PP Sbjct: 538 PPPPPPSPP 546 Score = 38.7 bits (86), Expect = 0.20 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P P P P P PP P P P Sbjct: 252 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Query: 809 XXXXXPP 829 PP Sbjct: 312 PPSPPPP 318 Score = 38.7 bits (86), Expect = 0.20 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 3/70 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPP---PXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXX 799 P P PPP PPP P PPP P P PP P P Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 438 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 439 PPPPSPPPPP 448 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P P P P P Sbjct: 343 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 402 Query: 809 XXXXXPP 829 PP Sbjct: 403 PPPPSPP 409 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P PPP P P PP P P P Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407 Query: 809 XXXXXPP 829 PP Sbjct: 408 PPPPSPP 414 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P PPP P P PP P P P Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451 Query: 809 XXXXXPP 829 PP Sbjct: 452 PPPPPPP 458 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P P P P P Sbjct: 457 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 516 Query: 809 XXXXXPP 829 PP Sbjct: 517 PPPPSPP 523 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P PPP P P PP P P P Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521 Query: 809 XXXXXPP 829 PP Sbjct: 522 PPPPSPP 528 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP P P P P PP P P P Sbjct: 260 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPS 319 Query: 809 XXXXXPP 829 PP Sbjct: 320 PPPPSPP 326 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP P P P P PP P P P Sbjct: 317 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376 Query: 809 XXXXXPP 829 PP Sbjct: 377 PPPPSPP 383 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415 Query: 809 XXXXXP 826 P Sbjct: 416 PSPPPP 421 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP P P P P PP P P P Sbjct: 415 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 474 Query: 809 XXXXXPP 829 PP Sbjct: 475 PPSPPPP 481 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 Query: 809 XXXXXP 826 P Sbjct: 530 PSPPPP 535 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP P P P P PP P P P Sbjct: 475 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Query: 809 XXXXXPP 829 PP Sbjct: 535 PSPPPPP 541 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P PP P P P Sbjct: 493 PPSPPPPPPPSPPPPPP---PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 549 Query: 809 XXXXXPP 829 PP Sbjct: 550 PPPPSPP 556 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P PP P P Sbjct: 212 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Query: 809 XXXXXPP 829 PP Sbjct: 272 SPPPPPP 278 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P P P P P Sbjct: 224 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 283 Query: 809 XXXXXPP 829 PP Sbjct: 284 PPPPSPP 290 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P P P P P Sbjct: 242 PPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 301 Query: 809 XXXXXPP 829 PP Sbjct: 302 PPPPSPP 308 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P P P P P P Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 327 Query: 809 XXXXXPP 829 PP Sbjct: 328 PSPPPPP 334 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Query: 809 XXXXXPP 829 PP Sbjct: 450 PSPPPPP 456 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 454 Query: 809 XXXXXPP 829 PP Sbjct: 455 PPPPSPP 461 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P P Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Query: 809 XXXXXPP 829 PP Sbjct: 458 PSPPPPP 464 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 400 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 459 Query: 809 XXXXXPP 829 PP Sbjct: 460 PPPPPPP 466 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P P P P P Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Query: 809 XXXXXPP 829 PP Sbjct: 465 PPSPPPP 471 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P P Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 467 Query: 809 XXXXXPP 829 PP Sbjct: 468 PPPPSPP 474 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P P P P P Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 472 Query: 809 XXXXXPP 829 PP Sbjct: 473 PPPPSPP 479 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P P P PPPP PP P P P PP P P P Sbjct: 225 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 284 Query: 806 XXXXXXPP 829 PP Sbjct: 285 PPPSPPPP 292 Score = 36.7 bits (81), Expect = 0.80 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P PP PP P P P PP P P P Sbjct: 207 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Query: 806 XXXXXXPP 829 PP Sbjct: 267 SPPPPSPP 274 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P PP PP P P P PP P P P Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Query: 806 XXXXXXPP 829 PP Sbjct: 262 SPPPPSPP 269 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPP-PXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P PPP PPP P PPP P P PP P P P Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Query: 806 XXXXXXPP 829 PP Sbjct: 306 SPPPPPPP 313 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSP--PPPSPPPPSPPPPSPPPPSPPPPPPP 434 Query: 809 XXXXXPP 829 PP Sbjct: 435 SPPPPPP 441 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP +PPP P PP P P P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 249 Query: 809 XXXXXPP 829 PP Sbjct: 250 PPPPSPP 256 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP +PPP P PP P P P Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 254 Query: 809 XXXXXPP 829 PP Sbjct: 255 PPPPPPP 261 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP +PPP P PP P P P Sbjct: 200 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Query: 809 XXXXXPP 829 PP Sbjct: 260 PPSPPPP 266 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP PPP P P PP P P Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497 Query: 818 XXPP 829 PP Sbjct: 498 PPPP 501 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P P P P P PP P P P Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 368 Query: 809 XXXXXPP 829 PP Sbjct: 369 PPPPSPP 375 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP +PPP P PP P P P Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 435 Query: 809 XXXXXPP 829 PP Sbjct: 436 PPPPPPP 442 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP PPP P P PP Sbjct: 519 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P P Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Query: 809 XXXXXP 826 P Sbjct: 295 PSPPPP 300 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P P P P P PP P P P Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298 Query: 809 XXXXXPP 829 PP Sbjct: 299 PPSPPPP 305 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP P P P P PP P P P Sbjct: 361 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Query: 809 XXXXXP 826 P Sbjct: 421 PSPPPP 426 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP +PPP P PP P P P Sbjct: 187 PGIPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 244 Query: 809 XXXXXPP 829 PP Sbjct: 245 PPPPSPP 251 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPP PPP P PP P P P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 272 Query: 809 XXXXXPP 829 PP Sbjct: 273 PPPPPPP 279 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P P Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Query: 809 XXXXXP 826 P Sbjct: 352 PSPPPP 357 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP PPP P P PP P P Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Query: 809 XXXXXPP 829 PP Sbjct: 373 SPPPPPP 379 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 405 Query: 809 XXXXXP 826 P Sbjct: 406 PSPPPP 411 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P P P P P PP P P P Sbjct: 354 PPPPSPPPP-SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 412 Query: 809 XXXXXPP 829 PP Sbjct: 413 PPPPSPP 419 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 519 Query: 809 XXXXXP 826 P Sbjct: 520 PSPPPP 525 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P P P P P PP P P P Sbjct: 468 PPPPSPPPP-SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 526 Query: 809 XXXXXPP 829 PP Sbjct: 527 PPPPSPP 533 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Query: 809 XXXXXPP 829 PP Sbjct: 254 SPPPPPP 260 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Query: 809 XXXXXPP 829 PP Sbjct: 259 PPPSPPP 265 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Query: 809 XXXXXPP 829 PP Sbjct: 277 PPPSPPP 283 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP PP P P PP P P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Query: 809 XXXXXPP 829 PP Sbjct: 329 SPPPPPP 335 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PP PP P P P PP P P Sbjct: 507 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPS 2726 Query: 809 XXXXXPP 829 PP Sbjct: 2727 PPPPSPP 2733 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PP P P PP P P P Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 Query: 809 XXXXXP 826 P Sbjct: 2740 PSPPPP 2745 Score = 37.9 bits (84), Expect = 0.35 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PP P P PP P P Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPP 253 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P P P P Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 36.7 bits (81), Expect = 0.80 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 210 PPPPLPPPPP--PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 213 PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSP--PPPPPPSPPPPPPPPLP 261 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP +PPP P P PP Sbjct: 2259 PPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PP P P PP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPP 2571 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP +PPP P PP P P P Sbjct: 2690 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2749 Query: 809 XXXXXP 826 P Sbjct: 2750 PSPPPP 2755 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP +PPP P PP P P P Sbjct: 2695 PPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2754 Query: 809 XXXXXP 826 P Sbjct: 2755 PSPPPP 2760 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP +PPP P PP P P P Sbjct: 2715 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Query: 809 XXXXXPP 829 PP Sbjct: 2775 SPPPSPP 2781 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP PPP P P PP P P P Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Query: 809 XXXXXP 826 P Sbjct: 2315 PSQPPP 2320 Score = 34.7 bits (76), Expect = 3.2 Identities = 21/85 (24%), Positives = 22/85 (25%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP P PP PP P P PP P P P Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Query: 818 XXPPXXXXXXFFFXXXXXGARGGXP 892 P +F G G P Sbjct: 2315 PSQPPPCHQVWFDTNLLGGDLPGYP 2339 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P PPP P P PP P P Sbjct: 2711 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPS 2770 Query: 809 XXXXXPP 829 PP Sbjct: 2771 PPPPSPP 2777 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP P PP PPP P P PP P P P Sbjct: 2674 PSPPPSPPPPSPPPSPP--PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPS 2731 Query: 809 XXXXXPP 829 PP Sbjct: 2732 PPPPSPP 2738 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P PP P P Sbjct: 2717 PPPPSPPPP-SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPS 2775 Query: 809 XXXXXPP 829 PP Sbjct: 2776 PPPSPPP 2782 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP PPP P PP P P Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P P PP PPPP +PPP P P P Sbjct: 2547 PPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPP 2585 Score = 33.1 bits (72), Expect = 9.9 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP PP P P PP P P P Sbjct: 2678 PSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSP 2737 Query: 818 XXP 826 P Sbjct: 2738 PPP 2740 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP +PPP P PP Sbjct: 2744 PPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Query: 809 XXXXXPP 829 PP Sbjct: 268 PPSPSPP 274 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Query: 809 XXXXXPP 829 PP Sbjct: 277 PPPPSPP 283 Score = 41.9 bits (94), Expect = 0.021 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Query: 809 XXXXXP-PXXXXXXFF 853 P P FF Sbjct: 279 PPSPPPAPPPFVPGFF 294 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P PP P P P Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Query: 809 XXXXXPP 829 PP Sbjct: 278 PPPSPPP 284 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Query: 809 XXXXXPP 829 PP Sbjct: 270 SPSPPPP 276 Score = 39.9 bits (89), Expect = 0.086 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P P PP P P P Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Query: 818 XXP 826 P Sbjct: 267 PPP 269 Score = 38.7 bits (86), Expect = 0.20 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P+ P PPP PPP PPP P P PP P P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P P PP P P P Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Query: 809 XXXXXP 826 P Sbjct: 275 PPPPPP 280 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P PP P P P Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Query: 809 XXXXXPP 829 PP Sbjct: 269 PSPSPPP 275 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Query: 818 XXPP 829 PP Sbjct: 263 SPPP 266 >UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep: Cecropin - Acalolepta luxuriosa (Udo longicorn beetle) Length = 60 Score = 42.3 bits (95), Expect = 0.016 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +1 Query: 157 FVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGP-AIEVLGSAKAIGK 321 FVFAL + L++T A + FK+IEK+G+NIR+ ++ P + G AK IGK Sbjct: 7 FVFALAVLLALTGQAESKNF--FKRIEKVGKNIRNAAERSLPTVVGYAGVAKQIGK 60 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 41.9 bits (94), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP GG P PP PPP P P Sbjct: 1036 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQP 1075 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 1010 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1041 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 1023 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1054 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 1049 PPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPP 1080 Score = 39.9 bits (89), Expect = 0.086 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P + P Sbjct: 944 PPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPP 983 Score = 39.9 bits (89), Expect = 0.086 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P + P Sbjct: 957 PPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPP 996 Score = 39.5 bits (88), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 1122 PPPPPPPMRGGAPPPPPPPGGRGPGAPPPPP 1152 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 970 PPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPP 1001 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 1086 PPPPPPPMRGGAPPPPPPPMRGGAPPPPPPP 1116 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 1098 PPPPPPPMRGGAPPPPPPPMHGGAPPPPPPP 1128 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 1110 PPPPPPPMHGGAPPPPPPPMRGGAPPPPPPP 1140 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 983 PPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPP 1014 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 943 PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPP 974 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 956 PPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPP 987 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 969 PPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPP 1000 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP G PPPP PPP P PP P P P Sbjct: 1088 PPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGA 1147 Query: 812 XXXXPP 829 PP Sbjct: 1148 PPPPPP 1153 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP G PPPP PPP P P PP P P Sbjct: 1112 PPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPG 1171 Query: 812 XXXXPP 829 PP Sbjct: 1172 GGPPPP 1177 Score = 36.7 bits (81), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P PP Sbjct: 1076 PPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPP 1112 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPP G P PP PPP P P Sbjct: 1011 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP 1050 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPP G P PP PPP P P Sbjct: 1024 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPP 1063 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG PP PPP P Sbjct: 1062 PPPPPPPMFGGAQPPPPPPMRGGAPPPPPPP 1092 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 1122 PPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPP 1153 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PP P Sbjct: 982 PPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPP 1013 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP G PPPP PPP P PP Sbjct: 1037 PPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPP 1076 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G PP GPPP P Sbjct: 1134 PPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPP 1165 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP G PPPP PPP P PP Sbjct: 936 PPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPP 970 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP 733 P PPP G PPP +PPP P P Sbjct: 971 PPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPP 1002 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPP PPP P PP Sbjct: 1064 PPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPP 1100 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPP P PP PPP P + P Sbjct: 971 PPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIP 1010 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPP G P PP PPP Sbjct: 1062 PPPPPPPMFGGAQPPPPPPMRGGAPPPPPP 1091 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP G PPPP PPP PP P P Sbjct: 1098 PPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAP 1148 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 628 PPXPPPPPXXGG-XPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP G PP P Sbjct: 1145 PGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPP 1177 >UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecropin-D - Antheraea pernyi (Chinese oak silk moth) Length = 36 Score = 41.9 bits (94), Expect = 0.021 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 214 WKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK 321 W FK++E+ G+ +RD I+ AGPA+ + A A+ K Sbjct: 1 WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK 36 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 41.5 bits (93), Expect = 0.028 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP +PPP P P PP P P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPP PPP P P PP P P Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PP P P PP P P P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 Query: 818 XXP 826 P Sbjct: 546 EIP 548 Score = 33.1 bits (72), Expect = 9.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P P P P Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPP----PPPPPPPPPPGPSPITPSVRPEIP 548 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Query: 809 XXXXXPP 829 PP Sbjct: 287 PPPPPPP 293 Score = 41.5 bits (93), Expect = 0.028 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Query: 809 XXXXXP 826 P Sbjct: 300 PPPVYP 305 Score = 41.1 bits (92), Expect = 0.037 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P P PP P P P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Query: 809 XXXXXPP 829 PP Sbjct: 296 PPPPPPP 302 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Query: 809 XXXXXPP 829 PP Sbjct: 288 PPPPPPP 294 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Query: 809 XXXXXPP 829 PP Sbjct: 289 PPPPPPP 295 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Query: 809 XXXXXPP 829 PP Sbjct: 291 PPPPPPP 297 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P P PP P P P Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Query: 809 XXXXXPP 829 PP Sbjct: 295 PPPPPPP 301 Score = 40.3 bits (90), Expect = 0.065 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPP-PXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP PPP P +PPP P P PP P P P Sbjct: 221 PLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Query: 806 XXXXXXPP 829 PP Sbjct: 281 PPPPPPPP 288 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P PPPP PPP P P PP P P P Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Query: 809 XXXXXPP 829 PP Sbjct: 275 PSPPPPP 281 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP +PPP P P PP P P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Query: 809 XXXXXPP 829 PP Sbjct: 286 PPPPPPP 292 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP P P P P PP P P P Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Query: 809 XXXXXPP 829 PP Sbjct: 284 PPPPPPP 290 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP PPP P P PP P P P Sbjct: 232 PSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Query: 809 XXXXXPP 829 PP Sbjct: 292 PPPPPPP 298 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PP PPPP PPP P P P P P P Sbjct: 213 PLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Query: 809 XXXXXPP 829 PP Sbjct: 273 PPPSPPP 279 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 564 PPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPP 595 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 565 PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPP 596 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP G P P Sbjct: 577 PPPPPPPPSSGGPPPPPPPPGGMKKPGAPAVP 608 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP PP GG P PP G PP P Sbjct: 549 PPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPP 580 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP P PP GG P PP GPPP P Sbjct: 550 PPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPP 581 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP PP GPPP P Sbjct: 562 PPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP 593 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 954 PPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPP 985 Score = 41.5 bits (93), Expect = 0.028 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PPP P Sbjct: 966 PPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 953 PPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPP 984 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP G PPPP PPP P PP Sbjct: 955 PPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 >UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|Rep: Cecropin-B precursor - Anopheles gambiae (African malaria mosquito) Length = 60 Score = 41.5 bits (93), Expect = 0.028 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 133 MNFAKILSFV-FALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAK 309 MNF K+ V A+++ + + PRWK K++EK+GRN+ KA P V+ K Sbjct: 1 MNFTKLFILVAIAVLVVVGVQPVDGAPRWKFGKRLEKLGRNVFRAAKKALP---VIAGYK 57 Query: 310 AIG 318 A+G Sbjct: 58 ALG 60 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 41.1 bits (92), Expect = 0.037 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGP 275 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 223 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 668 PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXXPP 829 PPPP +PPP P P PP P P P PP Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 4/67 (5%) Frame = +2 Query: 638 PXPP----PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P PP P PPPP PPP P P PP P P P Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Query: 806 XXXXXXP 826 P Sbjct: 271 PPKGPSP 277 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 41.1 bits (92), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP GPPP P Sbjct: 1056 PPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPP 1087 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 1070 PPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPP 1101 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 1071 PPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPP 1102 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG PP G PP P Sbjct: 1068 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1099 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP GPPP P Sbjct: 1069 PPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPP 1100 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP G PP P Sbjct: 1083 PPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPP 1114 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 1084 PPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPP 1115 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXXGG---XPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP GPPP P Sbjct: 1038 PPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPP 1072 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 40.3 bits (90), Expect = 0.065 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 39.9 bits (89), Expect = 0.086 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 PPP PPPP PPP P P PP P P P Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Query: 824 PP 829 PP Sbjct: 286 PP 287 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 274 Score = 37.1 bits (82), Expect = 0.61 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 PPP PPPP PPP P P PP P P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPL 293 Query: 824 P 826 P Sbjct: 294 P 294 Score = 36.7 bits (81), Expect = 0.80 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P P P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPP 284 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P+ PP PPPP PPP P P PP P P Sbjct: 228 PQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 40.3 bits (90), Expect = 0.065 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP P P P P PP P P P Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Query: 818 XXPP 829 PP Sbjct: 235 PSPP 238 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 178 PPPPSPPPPPPPSPPPPSPPPPSP---PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Query: 809 XXXXXPP 829 PP Sbjct: 235 PSPPPPP 241 Score = 38.7 bits (86), Expect = 0.20 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P P P P P PP P P P Sbjct: 180 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Query: 809 XXXXXPP 829 PP Sbjct: 240 PPPPSPP 246 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 R PPP PPPP PPP P P PP P P P Sbjct: 171 RGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPSPPPPSP 227 Query: 812 XXXXPP 829 PP Sbjct: 228 PPPSPP 233 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PP P PPP P PP P P P Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPS 244 Query: 809 XXXXXPP 829 PP Sbjct: 245 PPPPSPP 251 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP PPP P P PP Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PP P P PP P P Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Query: 809 XXXXXPP 829 PP Sbjct: 241 PPPSPPP 247 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP +PPP P PP P P P Sbjct: 192 PPPSPPPPSPP--PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPS 249 Query: 809 XXXXXPP 829 PP Sbjct: 250 PPPPSPP 256 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PP PP P P P PP P P Sbjct: 207 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 40.7 bits (91), Expect = 0.049 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP G PPPP AP P P + PP P P P Sbjct: 175 PPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPPDVVVKAPM 234 Query: 809 XXXXXP 826 P Sbjct: 235 WAFRTP 240 Score = 35.1 bits (77), Expect = 2.4 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 PPP PPPP PPP P P PP P P P Sbjct: 160 PPPEPEPAPPPPEPAPPTPEPPPPPGPEPP---PPPGPEPPPPPAPEPPPPPAPEPPPPP 216 Query: 824 PP 829 PP Sbjct: 217 PP 218 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP PPP P P PP P P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 37.1 bits (82), Expect = 0.61 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 60 PAPPPPPPP--PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 36.7 bits (81), Expect = 0.80 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PPP PPPP PPP P P PP P P Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 40.7 bits (91), Expect = 0.049 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP APPP P P PP Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PP P P PP P P Sbjct: 1090 PPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHHPSGP 1137 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 40.7 bits (91), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 156 PPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPP 206 Score = 37.5 bits (83), Expect = 0.46 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PP PP PPP P P PP P P Sbjct: 150 PSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASP 201 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 + P PPP PPP +PPP P P PP P P Sbjct: 148 KLPSPPPPPPPPSPPPPSPPSPPPPSPPPPP--PPSPPPPSPPPPSPSPP 195 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 40.7 bits (91), Expect = 0.049 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP APPP P P PP Sbjct: 57 PPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPP 96 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 40.3 bits (90), Expect = 0.065 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPP-PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PP P PPPP PPP P P PP P P P Sbjct: 812 PSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPP 871 Query: 806 XXXXXXPP 829 PP Sbjct: 872 PSPPPSPP 879 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P PP P P P Sbjct: 794 PLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPA 853 Query: 809 XXXXXPP 829 PP Sbjct: 854 PSPPPPP 860 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP PPP P P PP P P P Sbjct: 801 PPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPP 860 Query: 809 XXXXXP 826 P Sbjct: 861 NPPPAP 866 Score = 38.3 bits (85), Expect = 0.26 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PP PPP P P PP P P Sbjct: 841 PPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891 Score = 36.3 bits (80), Expect = 1.1 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPP--PXXXXXXXXXAPPPXP-XXPXKXPPXXXXXXXPXXPXXXXXX 799 P P PPP PPP P +PPP P P PP P P Sbjct: 821 PTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP 880 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 881 SPPPPPSPPP 890 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP AP P P P PP P P P Sbjct: 827 PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP--PPNPPPAPTPPPPPSPPPSPPPSPPP 884 Query: 809 XXXXXPP 829 PP Sbjct: 885 PPSPPPP 891 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P P +PPP P P PP P P Sbjct: 851 PPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PP P P P P P P Sbjct: 789 PSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPP 848 Query: 818 XXPP 829 PP Sbjct: 849 SPPP 852 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P P P P P Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPP 864 Query: 809 XXXXXPP 829 PP Sbjct: 865 APTPPPP 871 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP PP P P PP P P Sbjct: 844 PSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSP 894 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPP P P P P PP P P Sbjct: 848 PSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP P PP PPP P PP Sbjct: 863 PPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPP 902 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 40.3 bits (90), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP G P P PPP P P PP P P P Sbjct: 1035 PPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPP 1094 Query: 809 XXXXXPP 829 PP Sbjct: 1095 PPPPPPP 1101 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 40.3 bits (90), Expect = 0.065 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 142 PPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHP 192 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP GPPP P Sbjct: 197 PAPPPPPAPQGPPAPPPVEGPPPPKGPPPPP 227 Score = 37.1 bits (82), Expect = 0.61 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP PPP P P PP P P Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPP 194 Query: 809 XXXXXPP 829 PP Sbjct: 195 AEPAPPP 201 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P PP P P Sbjct: 136 PVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPA 195 Query: 809 XXXXXPP 829 PP Sbjct: 196 EPAPPPP 202 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPP PPP P P PP Sbjct: 174 PPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPP 213 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PPP P PP P P P Sbjct: 163 PPPPGPPPP--HPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPP 220 Query: 809 XXXXXPP 829 PP Sbjct: 221 KGPPPPP 227 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP P PP PPP P P PP Sbjct: 199 PPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPP 235 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPX--PXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP G PP PPP P P K PP P P P Sbjct: 209 PAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPP 268 Query: 812 XXXXP 826 P Sbjct: 269 HFPPP 273 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 40.3 bits (90), Expect = 0.065 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR P PPP PPPP PP P P PP P P Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPS 307 Query: 809 XXXXXPP 829 PP Sbjct: 308 PPVPPPP 314 Score = 39.9 bits (89), Expect = 0.086 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P K P P P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSP 316 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP PPP P P PP P P P Sbjct: 256 PSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPS 315 Query: 809 XXXXXP 826 P Sbjct: 316 PPSVLP 321 Score = 35.1 bits (77), Expect = 2.4 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 P P PP P +PPP P P PP P P P Sbjct: 222 PAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Query: 824 PP 829 PP Sbjct: 282 PP 283 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 R P PPP PPP PPP P P P P P P Sbjct: 240 RPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSP 299 Query: 812 XXXXP 826 P Sbjct: 300 PRKPP 304 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P P P PP PP P P P P PP P P P Sbjct: 228 PLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Query: 806 XXXXXXPP 829 PP Sbjct: 288 PPPPPPPP 295 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 39.9 bits (89), Expect = 0.086 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 609 PPPPPPPPPPGGGPPPP---PPPPGSGPPPPP 637 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP GPPP P Sbjct: 595 PPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPP 626 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 596 PPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPP 627 Score = 35.1 bits (77), Expect = 2.4 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 629 PRXPXPPPXXG---XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPPP APPP P P PP P P Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPP---PPGGGPPPPPPPP 629 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 39.9 bits (89), Expect = 0.086 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 661 PPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPP 692 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP G PP P Sbjct: 675 PPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPP 706 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G P PP PPP Sbjct: 690 PPPPPPPPSKTGAPPPPPPPRIGGAPPPPP 719 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXP--PPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P PP PPPP APPP P P PP P P Sbjct: 659 PPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPP---PPSKTGAPPPPPP 708 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPP G P PP PPP Sbjct: 691 PPPPPPPSKTGAPPPPPPPRIGGAPPPPPP 720 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP PP PPP P Sbjct: 688 PPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPP 719 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 39.9 bits (89), Expect = 0.086 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G P PP GPPP Sbjct: 367 PPPPPPPPPKGAPPPPPPPPPPPPPPGPPP 396 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 + P PPP G PPPP PPP P PP P P Sbjct: 951 KAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPP 1000 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP P PP P P Sbjct: 934 PPPPPLPGFVPPPP---VVGKAPPPPPLPGMVPPPPPPLPGMAPPPPP 978 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P P PP Sbjct: 940 PGFVPPPPVVGKAPPPP----PLPGMVPPPPPPLPGMAPP 975 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P P PP P P Sbjct: 607 PPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPP 666 Query: 818 XXPP 829 PP Sbjct: 667 PPPP 670 Score = 36.7 bits (81), Expect = 0.80 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXXG--XXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P P PP Sbjct: 626 PGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPP 667 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = +2 Query: 629 PRXPXPPPXXG-XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP G PPP PPP P P PP P P P Sbjct: 638 PGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMP 697 Query: 806 XXXXXXP 826 P Sbjct: 698 PPPPGMP 704 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 673 PGMPPPPPGMPGMPPPP---PPGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 720 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 647 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 629 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 659 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPP--XPXXPXKXPPXXXXXXXPXXP 781 P P PP G PPPP PPP P P PP P P Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 669 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PP P P PP P P Sbjct: 655 PPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMP 714 Query: 818 XXPP 829 PP Sbjct: 715 GMPP 718 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 605 PPPPPPPGASSIPPPPPPPGMPGMPPPPPPP 635 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 627 PPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPP 666 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 652 PPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPP 683 Score = 37.5 bits (83), Expect = 0.46 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 3/70 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXX---PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXX 799 P P PPP G PPPP PPP P P PP P Sbjct: 611 PPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPP 670 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 671 PPLSGAGPPP 680 Score = 36.7 bits (81), Expect = 0.80 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPPPP G P PP PPP P P Sbjct: 640 PPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGP 678 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 640 PPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPP 671 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 628 PPXPPP-PPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP PP G P PP PPP P Sbjct: 626 PPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPP 658 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 641 PPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPP 672 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P P P P G PPPP PPP P K P Sbjct: 654 PPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPGLKTKKP 692 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 19 PHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 R PPP PPPP PPP P P PP P P Sbjct: 13 RVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PP PPPP PPP P P PP P P Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 39.5 bits (88), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP GPPP P Sbjct: 370 PPPPPPPPFGNAPPPPPPPPGSKIPGPPPPP 400 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P P P Sbjct: 372 PPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGP 408 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP GPPP P Sbjct: 382 PPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412 Score = 35.5 bits (78), Expect = 1.9 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P+ PPP PPPP APPP P P PP P P P Sbjct: 283 PQQQSPPPPP-PPPPPPLPNSTSNVTAPPPPPPPP---PPPLPNSQAPPPPPPPPPPPPI 338 Query: 809 XXXXXPP 829 PP Sbjct: 339 PGQQNPP 345 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXX-PPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP APPP P P P Sbjct: 330 PPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARP 370 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G PP PPP P P Sbjct: 344 PPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPP 383 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PPPP PPP P PP P P Sbjct: 358 PPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGP 408 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPP--XPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 370 PPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPP 411 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 39.1 bits (87), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP GG P PP PPP Sbjct: 466 PPPPPPPPFPGGVPPPPPLPGGAPPPPPPP 495 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG PP PPP P Sbjct: 439 PPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPP 470 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 P PPPPP GG P PP PPP Sbjct: 454 PPPPPPPGMGGAPPPPPPPPFPGGVPPPP 482 Score = 35.9 bits (79), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP G PPPP PPP P PP P P Sbjct: 467 PPPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 454 PPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLP 485 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PP G PPPP PPP P PP P P Sbjct: 480 PPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLP 527 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 39.1 bits (87), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXA-PPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP A PPP P P PP P P Sbjct: 926 PPPPPPPPQAALPPPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPP 977 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 911 PPAPPPPPLLSEAPLPPPPPPPPQAALPPPPP 942 Score = 33.1 bits (72), Expect = 9.9 Identities = 20/72 (27%), Positives = 20/72 (27%), Gaps = 5/72 (6%) Frame = +2 Query: 629 PRXPXPPPXXGXXP-----PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXX 793 P P PPP G P PPP PPP P PP P Sbjct: 895 PPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALP 954 Query: 794 XXXPXXXXXXPP 829 P PP Sbjct: 955 PPPPAPPPPGPP 966 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 650 PPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPPPP 697 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 626 PPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPP 662 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 638 PPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPP 674 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 648 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPLP 678 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PP PPP P P PP Sbjct: 657 PGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPPP 696 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P PP Sbjct: 614 PPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPP 650 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 624 PPPPPPPGASSVPPPPPPPGASSVPPPPPPP 654 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 636 PPPPPPPGASSVPPPPPPPGMPGMPPPPPPP 666 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPP PPP P PP P P Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMP 660 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 39.1 bits (87), Expect = 0.15 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P P PP P P Sbjct: 39 PLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPS 98 Query: 818 XXPP 829 PP Sbjct: 99 PPPP 102 Score = 39.1 bits (87), Expect = 0.15 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P PP P P P Sbjct: 67 PSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPS 126 Query: 809 XXXXXPP 829 PP Sbjct: 127 PSPPSPP 133 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P PP P P P Sbjct: 22 PPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPS 81 Query: 809 XXXXXPP 829 PP Sbjct: 82 PPPPSPP 88 Score = 37.5 bits (83), Expect = 0.46 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP +PPP P P PP P P P Sbjct: 45 PPPSPPPPSPPPSPPPPLPPPSPSPPSPPP-PSPPPPSPPPPSPPSPPPSPPPPSPPPPS 103 Query: 809 XXXXXPP 829 PP Sbjct: 104 PPPPSPP 110 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP PP P P PP P P P Sbjct: 49 PPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPS 108 Query: 809 XXXXXPP 829 PP Sbjct: 109 PPPPSPP 115 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP +PPP P P PP P P P Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSP--PPPLPPPSPSPPSPPPPSPPPPSPPP 84 Query: 809 XXXXXPP 829 PP Sbjct: 85 PSPPSPP 91 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP +PPP P P PP Sbjct: 96 PPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P PP P P Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPS 131 Query: 809 XXXXXPP 829 PP Sbjct: 132 PPPPSPP 138 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP +PPP P PP P P P Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPS 141 Query: 809 XXXXXPP 829 PP Sbjct: 142 ISPSPPP 148 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPP PPP P P PP Sbjct: 195 PTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 34.3 bits (75), Expect = 4.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +2 Query: 638 PXPPPXXGXXP-PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXX 814 P PPP P PPP PPP P P PP P P P Sbjct: 20 PSPPPPSPPPPSPPPPSPPPLPPPLPPPSP-PPPSPPPSPPPPLPPPSPSPPSPPPPSPP 78 Query: 815 XXXPP 829 PP Sbjct: 79 PPSPP 83 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP PP P P PP P P Sbjct: 101 PPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPP 151 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAP-PPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP PPP P PP P P PP P P Sbjct: 85 PSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISP 144 Query: 806 XXXXXXPP 829 PP Sbjct: 145 SPPPPPPP 152 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 1/67 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PP PPPP PP P P P PP P P P Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPP 78 Query: 806 XXXXXXP 826 P Sbjct: 79 PPSPPPP 85 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PP PPPP +PPP P P PP P P Sbjct: 187 PSPPSSASPTPPPPSASPSPPPPSPPP-PSPPPPPPPPPPPPPSPPSP 233 Score = 33.1 bits (72), Expect = 9.9 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 1/63 (1%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPP-XPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXX 820 PPP PPPP PPP P P P P P P Sbjct: 198 PPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPP 257 Query: 821 XPP 829 PP Sbjct: 258 PPP 260 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 39.1 bits (87), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP APPP P P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPP 313 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP P PP APPP P P P Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PPP PPPP P P P P PP P P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 39.1 bits (87), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 37.9 bits (84), Expect = 0.35 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 39.1 bits (87), Expect = 0.15 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPPPP GG PP GPPP P P Sbjct: 244 PPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPP 282 Score = 37.1 bits (82), Expect = 0.61 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAP--PPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PP PPPP AP PP P P PP P P Sbjct: 143 PPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGAR 202 Query: 803 PXXXXXXPP 829 P PP Sbjct: 203 PGPPPPPPP 211 Score = 37.1 bits (82), Expect = 0.61 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P + PP P P Sbjct: 246 PPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRGPGAPPPP 293 Score = 36.7 bits (81), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 102 PPPPPPPPLLRSVPPPPPPPPISHSNAPPPPP 133 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPP G P PP PPP P + P Sbjct: 180 PPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 219 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP G PPPP PPP P PP Sbjct: 244 PPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPP 283 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 628 PPXPPPPPXXGGXP-XPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 203 PGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPP 235 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP PP PPP P Sbjct: 115 PPPPPPPPISHSNAPPPPPLPAARFNAPPPPP 146 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P PP P P Sbjct: 170 PPSPPPPPSP-PPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAP 219 Score = 33.1 bits (72), Expect = 9.9 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 6/70 (8%) Frame = +2 Query: 638 PXPPPXXGXX---PPPPXXXXXXXXXAPPPXPXXPXK---XPPXXXXXXXPXXPXXXXXX 799 P PPP PPPP APPP P P PP P P Sbjct: 129 PPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGA 188 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 189 RPGPPPPPPP 198 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPP PP P P PP Sbjct: 142 PPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPP 181 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 39.1 bits (87), Expect = 0.15 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 95 PARPPPPPPKSDAPPPPPARP------PPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPP 148 Query: 809 XXXXXPP 829 PP Sbjct: 149 PPAAIPP 155 Score = 37.5 bits (83), Expect = 0.46 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +2 Query: 638 PXPP-PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXX 814 P PP P G PPPP PPP P PP P P P Sbjct: 512 PAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPA 571 Query: 815 XXXPP 829 PP Sbjct: 572 GTPPP 576 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 522 PPPPPPPGAGAPPPPPPPAGGAPPPPPPPPP 552 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 533 PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPPXXGG--XPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP G PP P Sbjct: 544 PPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPP 577 Score = 35.1 bits (77), Expect = 2.4 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PP PPPP APPP P P PP P P P Sbjct: 90 PAAPPPARPPPPPPKSD------APPPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSN 143 Query: 818 XXPP 829 PP Sbjct: 144 DIPP 147 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP G P PP PPP P PP P P Sbjct: 499 PSAPPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPP 549 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 533 PPPPPPP--AGGAPPPPPPPPPKGGAPPPPPP 562 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 39.1 bits (87), Expect = 0.15 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXK 739 P P PPP PPPP PPP P P + Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXK 739 P P PPP PPPP PPP P P + Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 38.7 bits (86), Expect = 0.20 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PR P PP PPPP +PPP P P PP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 38.3 bits (85), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 244 PPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 36.7 bits (81), Expect = 0.80 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P P P P Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 239 PRPPPPP-MPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP +P P P P PP P P P Sbjct: 212 PAVRRPPP--SSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Query: 809 XXXXXPP 829 PP Sbjct: 270 PPPPPPP 276 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXA-PPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P P PPP P P PP P P P Sbjct: 219 PSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Query: 806 XXXXXXPP 829 PP Sbjct: 279 PLLPPLPP 286 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 38.7 bits (86), Expect = 0.20 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PP P PPP P P PP P P Sbjct: 548 PPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPP 598 Score = 37.5 bits (83), Expect = 0.46 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPP-XXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP PPPP +PPP P P PP P P Sbjct: 515 PPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSP 574 Query: 806 XXXXXXPP 829 PP Sbjct: 575 PPPSPPPP 582 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P PP P P Sbjct: 538 PPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPP 597 Query: 809 XXXXXPP 829 PP Sbjct: 598 PSPPPPP 604 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P PP P P Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSP--PSPPPPSPSPPPSPPPP 550 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PPP +PPP P P PP P P Sbjct: 562 PSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSP 612 Score = 34.7 bits (76), Expect = 3.2 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 2/68 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXP--PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP P PPP A PP P P PP P P Sbjct: 531 PSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPP 590 Query: 803 PXXXXXXP 826 P P Sbjct: 591 PPPSPPPP 598 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXP-PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PPP PPP P PP P P Sbjct: 574 PPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 38.7 bits (86), Expect = 0.20 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXX---GGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP GPPP P Sbjct: 1061 PPPPPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPP 1095 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP GPPP P Sbjct: 843 PPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPP 874 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPPXXGG--XPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP G PP P Sbjct: 825 PPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPP 858 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXPPPXXGXX--PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPPP APPP P P PP P P Sbjct: 826 PPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPP---PPGSKTGPPPPPP 875 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP G P PP GPPP P Sbjct: 874 PPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPP 905 Score = 34.7 bits (76), Expect = 3.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +2 Query: 629 PRXPXPPPXXG--XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP G PPPP PPP P P PP P P Sbjct: 841 PPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPP---PPGAKTGSAPPPPPPPGGPR 897 Query: 803 PXXXXXXP 826 P P Sbjct: 898 PPGPPPPP 905 Score = 33.9 bits (74), Expect = 5.7 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 6/73 (8%) Frame = +2 Query: 629 PRXPXPPPXXGXX------PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXX 790 P P PPP G PPPP APPP P P P P Sbjct: 807 PPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGS 866 Query: 791 XXXXPXXXXXXPP 829 P PP Sbjct: 867 KTGPPPPPPPPPP 879 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP P PP PPP P Sbjct: 828 PPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPP 859 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXX--GXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P PP Sbjct: 872 PPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPP 913 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 38.7 bits (86), Expect = 0.20 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXXG---GXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G G P PP GPPP P Sbjct: 633 PPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPP 667 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXX--GXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P K PP Sbjct: 635 PPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKAPP 676 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 38.7 bits (86), Expect = 0.20 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP G PP P Sbjct: 630 PPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPP 661 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP GPPP P Sbjct: 631 PPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPP 662 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 604 PPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPP 635 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPP PPP P PP P P Sbjct: 605 PPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPP 655 >UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein - Yarrowia lipolytica (Candida lipolytica) Length = 1329 Score = 38.7 bits (86), Expect = 0.20 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP PPP P P PP P P P Sbjct: 898 PPPPPATERSAPPPPPERAAAPPPPPPVPGSPQVPPPSMPHQHAPAVPGAPAPPVPHAVP 957 Query: 818 XXPP 829 PP Sbjct: 958 PPPP 961 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 362 PPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPP 393 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP GPPP P Sbjct: 376 PPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPP 407 Score = 36.7 bits (81), Expect = 0.80 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 6/73 (8%) Frame = +2 Query: 629 PRXPXPPPXXG--XXPPPPXXXXXXXXXAPPPXPXXP----XKXPPXXXXXXXPXXPXXX 790 P P PPP G PPPP APPP P P PP P P Sbjct: 360 PPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAG 419 Query: 791 XXXXPXXXXXXPP 829 P PP Sbjct: 420 PPPPPPPPGCGPP 432 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PP P Sbjct: 420 PPPPPPPPGCGPPPPPPMGSFGQKPENPPRKP 451 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP GPPP P Sbjct: 407 PPPPPPPGLPGAGPPPP---PPPPGCGPPPPP 435 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPPXXGG--XPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP G PP P Sbjct: 359 PPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPP 392 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 38.3 bits (85), Expect = 0.26 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 520 PSPPSPPPPPS--PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 577 Query: 809 XXXXXP 826 P Sbjct: 578 SPPPPP 583 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 512 PPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 571 Query: 809 XXXXXP 826 P Sbjct: 572 SPPPPP 577 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 526 PPPPSPPPPPS--PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 583 Query: 809 XXXXXP 826 P Sbjct: 584 SPRHPP 589 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 532 PPPPSPPPPPS--PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Query: 809 XXXXXP 826 P Sbjct: 590 SPPPRP 595 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP-XXPXKXPPXXXXXXXPXXPXXXXXXXP 805 PR P P P P PP +PPP P P PP P P P Sbjct: 510 PRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Query: 806 XXXXXXPP 829 PP Sbjct: 570 PPSPPPPP 577 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXP-PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P PPP PPP P PP P P P Sbjct: 522 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Query: 806 XXXXXXPP 829 PP Sbjct: 582 PPSPRHPP 589 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP P PP +PPP P P PP Sbjct: 564 PPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPP 603 Score = 35.1 bits (77), Expect = 2.4 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP--PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 PR P P P PP PP PPP P PP P P Sbjct: 515 PRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 574 Query: 803 PXXXXXXPP 829 P PP Sbjct: 575 PPPSPPPPP 583 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P P P P P P Sbjct: 528 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS-PPPPPSPPPPPSPPPPPSPPPPPSPR 586 Query: 809 XXXXXPP 829 PP Sbjct: 587 HPPSPPP 593 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP +PPP P P P P P P Sbjct: 546 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS-PPPPPSPRHPPSPPPRPRPPRPQPPS 604 Query: 809 XXXXXPP 829 PP Sbjct: 605 PPSPSPP 611 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 1/67 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXP-PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P PPP PPP P PP P P P Sbjct: 534 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Query: 806 XXXXXXP 826 P Sbjct: 594 RPRPPRP 600 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 38.3 bits (85), Expect = 0.26 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P P Sbjct: 111 PPTPRPPPPPTPRPPPPPTPRP-----PPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPT 165 Query: 809 XXXXXPP 829 PP Sbjct: 166 PPEPTPP 172 Score = 37.1 bits (82), Expect = 0.61 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR P P P PPPP PPP P P PP P P P Sbjct: 86 PRPPPPRPPTPRPPPPPTPRP------PPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPT 139 Query: 809 XXXXXPP 829 PP Sbjct: 140 PRPPPPP 146 Score = 37.1 bits (82), Expect = 0.61 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P P P P P P Sbjct: 93 PPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPT 152 Query: 809 XXXXXPP 829 PP Sbjct: 153 PSPPSPP 159 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR P P P PPP P P P + PP P P P Sbjct: 69 PRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPP 128 Query: 809 XXXXXPP 829 PP Sbjct: 129 TPRPPPP 135 Score = 33.9 bits (74), Expect = 5.7 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 3/70 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXP---PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXX 799 PR P P P P PP PPP P P PP P P Sbjct: 59 PRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPP 118 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 119 PPTPRPPPPP 128 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP P P P P P P P P Sbjct: 101 PPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPS 160 Query: 809 XXXXXPP 829 PP Sbjct: 161 PEPPTPP 167 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 38.3 bits (85), Expect = 0.26 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P P PP P P P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPPF 274 Query: 809 XXXXXP 826 P Sbjct: 275 AFGFRP 280 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P PP P P P Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPL 264 Query: 809 XXXXXP 826 P Sbjct: 265 PPPSIP 270 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPPP PPP P P PP P P P Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Query: 809 XXXXXP 826 P Sbjct: 268 SIPSPP 273 Score = 37.5 bits (83), Expect = 0.46 Identities = 21/75 (28%), Positives = 22/75 (29%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 + P PPP P PP PPP P P PP P P P Sbjct: 203 KYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPS-PPPPPPPPPPPSPPPPPSPPPPS 261 Query: 812 XXXXPPXXXXXXFFF 856 PP F F Sbjct: 262 PPLPPPSIPSPPFAF 276 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXP-PPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP P PPP PPP P PP P P P Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLP 265 Query: 806 XXXXXXPP 829 PP Sbjct: 266 PPSIPSPP 273 >UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr2 scaffold_140, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 1163 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 682 PPHPPPPPPSLGLPGPPPPPGAKGTNAPPPPP 713 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP GPPP P Sbjct: 758 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPPP 788 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP G PPPP PP P P PP P P Sbjct: 714 PPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPP 764 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPP---PPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP PP GG P PP PPP P Sbjct: 743 PPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPP 777 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PP G PPPP PPP P P PP Sbjct: 731 PPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPP 770 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PP P P P Sbjct: 759 PPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAP 795 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 628 PPXPPP-PPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP PP GG P PP G PP P Sbjct: 713 PPPPPGLPPITGGPPPPPPPGGLPPITGGPPPP 745 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 38.3 bits (85), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP APPP P P P Sbjct: 339 PPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGP 375 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 P PPPPP G P PP PPP Sbjct: 338 PPPPPPPGGAGPPPPPPPPPPGLPAPPPP 366 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 38.3 bits (85), Expect = 0.26 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP APPP P P P Sbjct: 950 PPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGP 986 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 P PPPPP G P PP PPP Sbjct: 949 PPPPPPPGGAGPPPPPPPPPPGLPAPPPP 977 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP GPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPP 314 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 284 PPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPP 315 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP GPPP P Sbjct: 982 PPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPP 1013 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXXG---GXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G G P PP G PP P Sbjct: 994 PPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPP 1028 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 628 PPXPPPPPXXG---GXPXPPXXXXXXXXXGPPP 717 PP PPPPP G G P PP PPP Sbjct: 1009 PPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPP 1041 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP G PP P Sbjct: 521 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPP 552 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 507 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 538 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P PP Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPP 536 >UniRef50_Q4SIS2 Cluster: Chromosome 21 SCAF14577, whole genome shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 21 SCAF14577, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1307 Score = 37.9 bits (84), Expect = 0.35 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP----PXPXXPXKXPP 748 PR P PPP G PPPP PP P P P PP Sbjct: 854 PRFPPPPPMLGSCPPPPPLIGIMRPPPPPLLNAPIPVPPPPEPP 897 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP PPP P P PP P P Sbjct: 315 PSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPP 374 Query: 809 XXXXXPP 829 PP Sbjct: 375 PPPEPPP 381 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPP--PXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPP P PPP P P PP P P Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPP 369 Query: 812 XXXXPP 829 PP Sbjct: 370 DRPPPP 375 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PP P PPP P PP P P P Sbjct: 314 PPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPP 373 Query: 809 XXXXXPP 829 PP Sbjct: 374 PPPPEPP 380 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDP-PPPPDPPPPPPPDPPPPPDPPPPD 370 Query: 809 XXXXXPP 829 PP Sbjct: 371 RPPPPPP 377 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P PP P P P Sbjct: 319 PPPPDPPPP--PDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPP 376 Query: 809 XXXXXPP 829 PP Sbjct: 377 PEPPPPP 383 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXP-PPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P P PP PP P PPP P P PP P P P Sbjct: 615 PNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPP 674 Query: 806 XXXXXXPP 829 PP Sbjct: 675 PTSSPPPP 682 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXX-GXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PR P PPP PPP PPP P P PP P P Sbjct: 512 PRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDP 563 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPP PPP P P PP Sbjct: 503 PPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPP 542 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643 Query: 809 XXXXXPP 829 PP Sbjct: 644 PPSPRPP 650 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P Sbjct: 594 PPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Query: 809 XXXXXPP 829 PP Sbjct: 654 PPSPPPP 660 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR P P P PP P PPP P P + PP P P Sbjct: 490 PRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSP-RPPPRPPPRPSSPRPPPPDPSPPP 548 Query: 809 XXXXXPP 829 PP Sbjct: 549 PSPPSPP 555 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P P P P P Sbjct: 482 PPPPSPPPPR-PPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPP 540 Query: 809 XXXXXPP 829 PP Sbjct: 541 PPDPSPP 547 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPX---PXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP PPPP +PPP P P PP P P P Sbjct: 312 PPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPP 371 Query: 809 XXXXXPP 829 PP Sbjct: 372 RASPPPP 378 Score = 35.9 bits (79), Expect = 1.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P PP P P Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSP--PPSPPPPATAAANPPSP 411 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP P PP PPP P PP P P P Sbjct: 289 PPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSP 348 Query: 818 XXPP 829 PP Sbjct: 349 SPPP 352 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXA--PPPXPXXPXKXPP 748 P PPP PPPP A PPP P P PP Sbjct: 357 PSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPP 395 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 37.9 bits (84), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PP PP P Sbjct: 614 PPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVP 645 Score = 37.5 bits (83), Expect = 0.46 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 5/72 (6%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP-----XKXPPXXXXXXXPXXPXXXX 793 P P PPP PPPP PPP P P PP P P Sbjct: 587 PPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPG 646 Query: 794 XXXPXXXXXXPP 829 P PP Sbjct: 647 IPPPPGAPGLPP 658 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXP----XXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 PPP G PPPP PPP P P PP P P P Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPP 588 Query: 812 XXXXPP 829 PP Sbjct: 589 PPPPPP 594 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P P PPP PPPP PPP P P P Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVP 575 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXA----PPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP P P PP P P Sbjct: 629 PPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPGAPGLPPPPP 680 Score = 34.7 bits (76), Expect = 3.2 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPX--XGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP G PPPP PPP P P PP P P P Sbjct: 615 PPPPPPPGAGGIPPPP---PPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPG 671 Query: 812 XXXXPP 829 PP Sbjct: 672 APGLPP 677 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 628 PPXPPPPPXXGG-XPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P P Sbjct: 561 PPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPP 601 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP P P P PP Sbjct: 548 PPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPP 587 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 37.9 bits (84), Expect = 0.35 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P P PP P P Sbjct: 301 PSAPPPPP-----PPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPP 346 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP PPP P Sbjct: 278 PPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPP 309 >UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 392 Score = 37.9 bits (84), Expect = 0.35 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP G PPPP PPP P PP P P P Sbjct: 327 PPAPPPPPATGFPPPPPPSVK------PPPPPSAAKPPPPPSEVKVPPPPPEVKVPPPPP 380 Query: 809 XXXXXPP 829 PP Sbjct: 381 EVKVPPP 387 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 37.9 bits (84), Expect = 0.35 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP-XKXPPXXXXXXXPXXPXXXXXXXPXXX 814 P PPP G PPP PPP P P PP P P P Sbjct: 299 PPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGP 358 Query: 815 XXXPP 829 PP Sbjct: 359 PPPPP 363 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P P Sbjct: 287 PPPPPPPPHNSGPPPPP----ARGRGAPPPPPSRAPTAAP 322 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPPP PPP P PP P P Sbjct: 278 PPPPPSRGGPPPPPPPPHNS---GPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAV 334 Query: 818 XXPP 829 PP Sbjct: 335 PPPP 338 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP GPPP P Sbjct: 556 PPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPP 587 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP P G P PP GPPP P Sbjct: 585 PPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPP 616 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP GPPP P Sbjct: 570 PPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPP 601 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 631 PXPPPPPXXG---GXPXPPXXXXXXXXXGPPP 717 P PPPPP G G P PP GPPP Sbjct: 612 PPPPPPPIPGMMTGPPSPPPPPLVATVVGPPP 643 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P GG P PP PPP P Sbjct: 393 PPPPPPLPGMGGIPPPPPLPGMGGIPPPPPLP 424 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPP P GG P PP PPP P Sbjct: 406 PPPPPLPGMGGIPPPPPLPGLGGIPPPPPLP 436 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPP P GG P PP PPP P Sbjct: 418 PPPPPLPGLGGIPPPPPLPGLAGIPPPPPLP 448 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P PPP G PPPP PPP P P P Sbjct: 93 PPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAPPPPP 128 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP PPP P Sbjct: 103 PPPPPPPMGGGAPPPP-----PGPGAPPPPP 128 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P PP P P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP 447 Query: 809 XXXXXP 826 P Sbjct: 448 PPSPQP 453 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP P PP PPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.7 bits (76), Expect = 3.2 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P P PP P P P Sbjct: 377 PSPPPPPPPPPPPP----------PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Query: 818 XXPP 829 PP Sbjct: 427 PPPP 430 Score = 33.9 bits (74), Expect = 5.7 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 3/70 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP---PXPXXPXKXPPXXXXXXXPXXPXXXXXX 799 P P PPP PPPP PP P P P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Query: 800 XPXXXXXXPP 829 P PP Sbjct: 439 SPPYVYPPPP 448 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP P P P PP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Query: 809 XXXXXPP 829 PP Sbjct: 443 VYPPPPP 449 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP +PPP P P PP P P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P P P PPPP +PPP P P PP P P P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCP-PPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Query: 818 XXP 826 P Sbjct: 111 SPP 113 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PP P P PP P P P Sbjct: 975 PPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPP 1034 Query: 809 XXXXXPP 829 PP Sbjct: 1035 PVARLPP 1041 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P PP P P Sbjct: 962 PPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPP 1021 Query: 809 XXXXXPP 829 PP Sbjct: 1022 PSPPPPP 1028 Score = 35.9 bits (79), Expect = 1.4 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP +PPP P P PP P P P Sbjct: 949 PLPPSPPPPTPPSPPPP--SPPPPVLSPPPSPPPPSPPPPAPPPPSPP--PPVPPPPSPP 1004 Query: 809 XXXXXPP 829 PP Sbjct: 1005 PPSPPPP 1011 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PP +PPP P P P P P Sbjct: 993 PPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWP 1043 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXX--APPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PP PPPP +PPP P PP P P Sbjct: 954 PPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSP 1013 Query: 803 PXXXXXXPP 829 P PP Sbjct: 1014 PPAAASPPP 1022 >UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 131 Score = 37.5 bits (83), Expect = 0.46 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PP P P PP P P Sbjct: 25 PLVPPPPPDHPLPPPPPKCSSTGAPPLAPPPPVPPPPPPPSPPCPTTPPPP 75 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 37.5 bits (83), Expect = 0.46 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPP P P P P PP P P P Sbjct: 884 PPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPP 943 Query: 809 XXXXXPP 829 PP Sbjct: 944 PPSPPPP 950 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PPP +PPP P P PP P P Sbjct: 906 PSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLP 956 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP P PP +PPP P PP P P Sbjct: 915 PPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPP 965 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PP P PP P P PP P P P Sbjct: 887 PSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPS 946 Query: 809 XXXXXPP 829 PP Sbjct: 947 PPPPSPP 953 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PP PPPP PP P PP P P P Sbjct: 898 PPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPP 957 Query: 818 XXPP 829 PP Sbjct: 958 PPPP 961 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP GG P PP PPP P Sbjct: 443 PPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMP 474 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 456 PPPPPPPMMPGVPMPPPMPGMGGAPRPPPMP 486 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPP P GG P PP GPPP P Sbjct: 468 PMPPPMPGMGGAPRPP----PMPGMGPPPPP 494 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P P P Sbjct: 512 PPPPPPGGSVPPPPPLPGGTCSSGPPPPPPPPTSIGP 548 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP GPPP P Sbjct: 511 PPPPPPP-GGSVPPPPPLPGGTCSSGPPPPP 540 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG PP PPP P Sbjct: 585 PPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMP 616 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXX--PPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P P PP Sbjct: 570 PPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPP 611 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P+ PPP PPPP APPP P P PP P P Sbjct: 544 PQIAPPPP-----PPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPP 589 Score = 35.1 bits (77), Expect = 2.4 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 7/74 (9%) Frame = +2 Query: 629 PRXPXPPPXXG-------XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXX 787 P P PPP G PPPP APPP P P PP P P Sbjct: 551 PPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPP---PPGGRLPPPPPPPPG 607 Query: 788 XXXXXPXXXXXXPP 829 P PP Sbjct: 608 GMPPPPPMPGRAPP 621 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PP PPPP PP P P PP P P Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPP 588 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 37.5 bits (83), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP PP GG P PP G PP P Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPP 594 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G PP GPPP P Sbjct: 576 PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPP 607 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXX--APPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPPP PPP P P PP P P P Sbjct: 584 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVT 643 Query: 812 XXXXPP 829 PP Sbjct: 644 RPPPPP 649 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXX--APPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPPP PPP P P PP P P P Sbjct: 698 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTR 757 Query: 812 XXXXPP 829 PP Sbjct: 758 PPTRPP 763 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXX--APPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPPP PPP P P PP P P Sbjct: 520 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQP 579 Query: 812 XXXXPP 829 PP Sbjct: 580 PVTRPP 585 Score = 33.1 bits (72), Expect = 9.9 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXX--APPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPPP PPP P P P P P P Sbjct: 645 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPT 704 Query: 812 XXXXPP 829 PP Sbjct: 705 RPPPPP 710 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P PP Sbjct: 776 PTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 812 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P P P PPPP PPP P P PP P P Sbjct: 811 PPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTG 870 Query: 803 PXXXXXXPP 829 P PP Sbjct: 871 PAPPPPPPP 879 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 823 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLP 854 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P G PPPP PPP P P P Sbjct: 847 PPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPPPIPPSMAP 886 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +2 Query: 638 PXPPPXXG-XXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP G PPPP PPP P P PP P P P Sbjct: 753 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 812 Query: 809 XXXXXP 826 P Sbjct: 813 PPPPLP 818 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 37.1 bits (82), Expect = 0.61 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPP PPP P PP P P Sbjct: 458 PPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPP 508 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 472 PPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPP 519 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 638 PXPPPXXG-XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP P PP P P Sbjct: 505 PPPPPMPGIGGPPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLPPPP 553 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 637 PPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PPPPP GG P PP PPP Sbjct: 527 PPPPPPMGGVPPPPPPMGGPVPLPPPP 553 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPP P GG P PP GPPP P P Sbjct: 505 PPPPPMPGIGGPPPPP-----MPGTGPPPPPPPMGGVPP 538 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P PP Sbjct: 849 PTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 885 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P P P PPPP PPP P P PP P P Sbjct: 884 PPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTG 943 Query: 803 PXXXXXXPP 829 P PP Sbjct: 944 PAPPPPPPP 952 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 896 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLP 927 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P G PPPP PPP P P P Sbjct: 920 PPPPPPLPGMGVPPPPPPPLTHTGPAPPPPPPPIPPSMAP 959 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +2 Query: 638 PXPPPXXG-XXPPPPXXXXXXXXXAPPPXP--XXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP G PPPP PPP P P PP P P P Sbjct: 826 PPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPP 885 Query: 809 XXXXXP 826 P Sbjct: 886 PPPPLP 891 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 349 PPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPP 380 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 322 PPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPP 353 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 350 PPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPP 381 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 335 PPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPP 366 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP PPP P Sbjct: 321 PPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPP 352 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PP P PPP P P PP Sbjct: 98 PPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 + P PPP PPPP +PPP P PP Sbjct: 88 KVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPP 126 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PP P P PP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 130 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PP P PPP P P PP Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 132 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPP PPP P P PP Sbjct: 1534 PHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPP 1570 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPP PPP P P PP P P Sbjct: 1406 PSPPHPPPSSGSSAPPP-----PPHSPPPPPPPPPPSSPPSPPPSPPPYTP 1451 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPP PPP P P P Sbjct: 1166 PSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSP 1205 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 1532 PSPPPPPPPPPPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 Score = 36.7 bits (81), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 1537 PPPPPPPPPSSSSPSPPPPPPPLPPPPPPPPP 1568 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 1532 PSPPPPPP-----PPPPPPSSSSPSPPPPPPPLPPPPPPP 1566 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 37.1 bits (82), Expect = 0.61 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 R P PPP PPPP PPP P PP P P Sbjct: 476 RLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPP 525 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 + P PPP G PPP PPP P P K PP P P P Sbjct: 486 KLPPPPPPPGGKLPPPPPPPPGGKLPPPPPP--PGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Query: 812 XXXXP 826 P Sbjct: 544 PPPPP 548 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP APPP P P K P P P Sbjct: 517 PGKAPPPPPGGKLPPPPPPGGKG---APPPPPPPPGKLGPGGGPPPPPPPP 564 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP P PP PPP P PP P P P Sbjct: 468 PPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGG 527 Query: 818 XXPP 829 PP Sbjct: 528 KLPP 531 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P PP P P Sbjct: 480 PPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKG 539 Query: 818 XXPP 829 PP Sbjct: 540 APPP 543 Score = 33.1 bits (72), Expect = 9.9 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPPP PPP PP P P P Sbjct: 501 PPPPPPGGKLPPPPPPPGK---APPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGP 557 Query: 818 XXPP 829 PP Sbjct: 558 PPPP 561 >UniRef50_Q6BI43 Cluster: Similar to CA6126|IPF143 Candida albicans IPF143; n=1; Debaryomyces hansenii|Rep: Similar to CA6126|IPF143 Candida albicans IPF143 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 985 Score = 37.1 bits (82), Expect = 0.61 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P G PPPP PPP P P PP P P Sbjct: 186 PPAPPGPHMMGYPPPPPGAPPFFHHLGPPPGPPPPGPPPPGPPPPGPPPGP 236 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 37.1 bits (82), Expect = 0.61 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPPP PPP P + PP P P Sbjct: 71 PPRPPPPPGYGEPPPPP--PPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPP 119 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P PPP G PPPP PPP P P Sbjct: 85 PPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPPP 120 >UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 347 Score = 37.1 bits (82), Expect = 0.61 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 638 PXPPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXX 814 P PPP G PP PP APPP P + PP P P P Sbjct: 79 PKPPPPIGKKPPMPPPASRKPSGMAPPPPSSSPARAPP-VPGGAPPAPPPAPPSSTPSAP 137 Query: 815 XXXPP 829 PP Sbjct: 138 PPPPP 142 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 37.1 bits (82), Expect = 0.61 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 525 PPPPPPPPLPGMCPVPPPPPLPRAGQIPPPPP 556 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 37.1 bits (82), Expect = 0.61 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXG--PPPXP 723 PP PPPPP G P PP G PPP P Sbjct: 589 PPPPPPPPITGSCPPPPPPPLPPPATGSCPPPPP 622 >UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Saccharomycetaceae|Rep: Branchpoint-bridging protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 518 Score = 37.1 bits (82), Expect = 0.61 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP APPP P PP P P P Sbjct: 425 PPPPPPSSLAPPPP---PPPSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSGI 481 Query: 818 XXPP 829 PP Sbjct: 482 APPP 485 >UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 270 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G RG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 210 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 33.5 bits (73), Expect = 7.5 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG RG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRG 212 >UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, periplasmic energy transduction protein TonB; n=1; Myxococcus xanthus DK 1622|Rep: Ferric siderophore transporter, periplasmic energy transduction protein TonB - Myxococcus xanthus (strain DK 1622) Length = 269 Score = 36.7 bits (81), Expect = 0.80 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP AP P P K PP Sbjct: 68 PPPPPPPPVVEAKPPPPPPPPPKPKLAPKPAPPAAAKAPP 107 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 36.7 bits (81), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPP PPP P K PP Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G PP GPPP P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P PP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 36.7 bits (81), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP P PP PPP P P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAP 562 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP G PP P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP 593 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP P PP PPP P Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP P PP PPP P Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 36.7 bits (81), Expect = 0.80 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P P PP P P Sbjct: 44 PGPPGPPPPSWHHPPPPDPF------APPPPPGPPGPPPPGPYSPPAPPGP 88 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 31 PFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDP 62 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 36.7 bits (81), Expect = 0.80 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PP PPP P P PP P P Sbjct: 625 PGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 675 Score = 35.5 bits (78), Expect = 1.9 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXPPPXX-GXXPPPPXXXXXXXXXA-PPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPPP PPP P P PP P P Sbjct: 679 PGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 731 Score = 34.3 bits (75), Expect = 4.3 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXK--XPPXXXXXXXPXXPXXXXXXXPXX 811 P PPP PPPP PPP P P P P P P Sbjct: 588 PPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPG 647 Query: 812 XXXXPP 829 PP Sbjct: 648 MPGMPP 653 Score = 33.5 bits (73), Expect = 7.5 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXPPPXXG--XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP G PPPP PPP P P PP P P Sbjct: 637 PGMPPPPPPPGMPGMPPPP----PGMPGMPPPPPGMPGMPPPPPGMPGMPPPP 685 Score = 33.1 bits (72), Expect = 9.9 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 5/56 (8%) Frame = +2 Query: 629 PRXPXPP-----PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP P PPPP PPP P P PP P P Sbjct: 610 PPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPP 665 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 36.7 bits (81), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 499 PPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPP 530 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP PP GPPP P Sbjct: 498 PPPPPPPPPSKSSGPPPPPPPPPKSSGPPPPP 529 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPP---XXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 497 PPPPPPPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 36.7 bits (81), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P PP Sbjct: 669 PPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPP 705 Score = 36.3 bits (80), Expect = 1.1 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 3/75 (4%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPP---PXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP G PPPP PP P P P P P P P Sbjct: 670 PPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPPGAPAPPAPGLPK 729 Query: 809 XXXXXPPXXXXXXFF 853 PP F+ Sbjct: 730 KPSPAPPVKTKAIFW 744 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 36.7 bits (81), Expect = 0.80 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPPP A P P P PP P P P Sbjct: 278 PPPPPAPGAAPPPP--KPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAA 335 Query: 818 XXPP 829 PP Sbjct: 336 APPP 339 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P PP Sbjct: 327 PAPPPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPPP 363 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 36.7 bits (81), Expect = 0.80 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLP 92 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P P P P Sbjct: 459 PPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPP 506 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P P P P Sbjct: 460 PPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPP 507 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP GPPP P Sbjct: 458 PPPPPPPPPP--PPPPPPTQSSAAGGGPPPPP 487 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P P PPP PPPP PPP P P P Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 572 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAP-PPXPXXPXKXPP 748 P P PPP PPPP P PP P P PP Sbjct: 532 PSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 572 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 637 PPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PPPPP GG P PP G PP P Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPPP 305 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPPXXG--GXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G G P PP PPP P Sbjct: 287 PPPPPPPPARGSRGAPPPPPPSRAPASAPPPPPP 320 Score = 35.1 bits (77), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 R P PPP G PPPP PP P P + P P P Sbjct: 275 RAPPPPPGRGGAPPPPPPPPARGSRGAPP-PPPPSRAPASAPPPPPPTRP 323 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P P PP Sbjct: 244 PAPPPQPIPPPPPPPPMPVESGSPPPPPPPPPPPPPP 280 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P PPPP PPP P P PP Sbjct: 246 PPPQPIPPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 >UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep: TonB-like - Caulobacter sp. K31 Length = 245 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPP--XPXXPXKXPP 748 P P PPP PPPP APPP P P PP Sbjct: 78 PPPPPPPPPTNAPPPPPAVVQPRPPIAPPPDVTPPPPLPIPP 119 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP APPP P PP P P P Sbjct: 931 PAPPPPPVVRPPPP-PPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPV 989 Query: 818 XXPP 829 PP Sbjct: 990 VRPP 993 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P PP P P P Sbjct: 981 PAPPPPPPVVRPPPPPP---PAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPP 1037 Query: 809 XXXXXPP 829 PP Sbjct: 1038 PPPPPPP 1044 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P PP P P Sbjct: 1004 PPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPP 1051 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 R PPP PPPP PPP P PP P P P Sbjct: 980 RPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPP 1039 Query: 812 XXXXP 826 P Sbjct: 1040 PPPPP 1044 Score = 33.5 bits (73), Expect = 7.5 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P PP P P Sbjct: 941 PPPPPPPPAAHPAPPPPVVRP-----APPPPPVVRQAPPPPPAARPAPPPP 986 >UniRef50_A5NQH0 Cluster: Putative uncharacterized protein precursor; n=1; Methylobacterium sp. 4-46|Rep: Putative uncharacterized protein precursor - Methylobacterium sp. 4-46 Length = 462 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP APPP P PP Sbjct: 311 PPPPPEPAPPPPPPVPEPVPEAAAPPPHHPEPEPPPP 347 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP A P P P PP Sbjct: 306 PVIPAPPPPPEPAPPPPPPVPEPVPEAAAPPPHHPEPEPP 345 >UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein - Acidiphilium cryptum (strain JF-5) Length = 320 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P+ P PPP PPPP PPP P P K P P P Sbjct: 104 PQPPVPPP----PPPPPTPAPTPIPTPPPPPPHPPQKQTPPKPAKKLPLPP 150 >UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 442 Score = 36.3 bits (80), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPP PPP P P PP P P Sbjct: 178 PNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSLP 225 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PP P PPP P P PP Sbjct: 2089 PPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PP P PPP P P PP Sbjct: 2084 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2123 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 638 PXPPPXXGXXPPP-PXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPP P +PPP P P PP Sbjct: 86 PSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPP 123 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP P PP PPP P P PP Sbjct: 2082 PSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPP 2118 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PP P +PPP P PP P P Sbjct: 2073 PSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2123 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PP P +PPP P PP P P Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 >UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 388 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPP 147 Query: 818 XXPP 829 PP Sbjct: 148 PSPP 151 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 92 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPP 151 Query: 818 XXPP 829 PP Sbjct: 152 PSPP 155 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 96 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPP 155 Query: 818 XXPP 829 PP Sbjct: 156 PSPP 159 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 100 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPP 159 Query: 818 XXPP 829 PP Sbjct: 160 PSPP 163 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPP P P P P PP P P P Sbjct: 104 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPP 163 Query: 818 XXPP 829 PP Sbjct: 164 PSPP 167 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 91 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 122 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 95 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 126 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 99 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 130 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 103 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 134 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 107 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 138 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 111 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNP 142 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 115 PPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSP 146 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 119 PPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSP 150 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 123 PPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSP 154 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 127 PPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSP 158 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 131 PPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSP 162 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P P PP PPP P Sbjct: 135 PPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSP 166 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 36.3 bits (80), Expect = 1.1 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXA-PPPXPXXPXK 739 P P PPP G PPPP A PPP P P K Sbjct: 1034 PIPPPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGK 1071 >UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|Rep: Predicted protein - Neurospora crassa Length = 452 Score = 36.3 bits (80), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPP 714 PP PPPPP GG P PP PP Sbjct: 6 PPPPPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 36.3 bits (80), Expect = 1.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P PP P P Sbjct: 240 PSAPPPPP--SFAPPPPSSAAPSLPPAPPPPPPTAAPRPPPAPSRSQPPPP 288 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G P PP G PP Sbjct: 5 PPPPPPPPPGMGGPPPPPPPPPGALPGRPP 34 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 36.3 bits (80), Expect = 1.1 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G GG G G GGG GGGG P G Sbjct: 403 GGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGPPGG 462 Query: 648 GG 643 GG Sbjct: 463 GG 464 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 722 GXGGGPXXXXXXXXLGGXGXPPXXGGGGGXGG 627 G GGGP GG G PP GGGGG GG Sbjct: 400 GGGGGPPG-------GGGGGPPGSGGGGGGGG 424 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXG 637 G G GG G GGG+ GGGG P GGG G Sbjct: 409 GGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGG 456 >UniRef50_Q8ZSX8 Cluster: Putative uncharacterized protein PAE3533; n=1; Pyrobaculum aerophilum|Rep: Putative uncharacterized protein PAE3533 - Pyrobaculum aerophilum Length = 533 Score = 36.3 bits (80), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP P PP PPP P + P Sbjct: 451 PPPPPPPPNVTDDPPPPPCPPGDPRCTPPPPPSPAPSSGP 490 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP PP P P Sbjct: 95 PAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPP 142 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PPP G PPPP APPP PP P P Sbjct: 75 PPPRDGSSPPPPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPP 120 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PP P PP P P Sbjct: 106 PPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPP 153 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 PPP G PPPP PPP PP P P P Sbjct: 129 PPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPPSGP 188 Query: 824 P 826 P Sbjct: 189 P 189 >UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; Gallus gallus|Rep: Putative uncharacterized protein - Gallus gallus (Chicken) Length = 1266 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G P PP PPP Sbjct: 692 PPPPPPPPVVPGCPPPPPPPPMVPGCPPPP 721 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGP 711 PP PPPPP G P PP GP Sbjct: 705 PPPPPPPPMVPGCPPPPGFSGPSAMDGP 732 >UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome virus|Rep: Wsv239 - White spot syndrome virus (WSSV) Length = 127 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP PPPP PPP P P PP Sbjct: 65 PPPPPSPPPPPPFVVPVPFPFVPPPPPSPPPPPPP 99 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PPP PPPP PPP P P PP P P Sbjct: 43 PPPPPSPPPPPPFVVPEPFPFVPPP-PPSPPPPPPFVVPVPFPFVP 87 >UniRef50_A1ULP9 Cluster: Transglycosylase domain protein precursor; n=4; Mycobacterium|Rep: Transglycosylase domain protein precursor - Mycobacterium sp. (strain KMS) Length = 433 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP AP P P P PP Sbjct: 141 PPPPPIDPFAPPPPPPAPFDALAAPAPAPLPPEAMPP 177 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPP P G P PP PPP P P Sbjct: 455 PPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPP 494 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P PPPP PPP P P PP Sbjct: 457 PPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPP 496 Score = 35.1 bits (77), Expect = 2.4 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXX-PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P P PP P P Sbjct: 453 PAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPP--PAPSPPAPPPPPPPCPP 502 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP-XKXPPXXXXXXXPXXP 781 P P PP PPPP PPP P P PP P P Sbjct: 442 PAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAP 493 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PP PP P PP GPPP P + P Sbjct: 441 PPAPPSPPAPS-PPAPPPPPPVPSPSGPPPPPPPPAPSPP 479 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P P PP +PPP P P PP P P Sbjct: 490 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSP 540 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP PP P P PP P P P Sbjct: 487 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPP 546 Query: 809 XXXXXPP 829 PP Sbjct: 547 SPPPSPP 553 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP PP P P PP P P P Sbjct: 491 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 550 Query: 809 XXXXXPP 829 PP Sbjct: 551 SPPPSPP 557 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP P P P P PP P P P Sbjct: 495 PSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 554 Query: 809 XXXXXPP 829 PP Sbjct: 555 SPPPSPP 561 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP P P P P PP P P P Sbjct: 499 PSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 558 Query: 809 XXXXXPP 829 PP Sbjct: 559 SPPPSPP 565 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP P P P P PP P P P Sbjct: 503 PSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 562 Query: 809 XXXXXPP 829 PP Sbjct: 563 SPPPSPP 569 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP PP P P PP P P P Sbjct: 510 PPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 569 Query: 809 XXXXXPP 829 PP Sbjct: 570 PSPPPPP 576 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP PP P P PP P P P Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPP 538 Query: 809 XXXXXPP 829 PP Sbjct: 539 SPPPSPP 545 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPP PP P P PP P P P Sbjct: 483 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPP 542 Query: 809 XXXXXPP 829 PP Sbjct: 543 SPPPSPP 549 Score = 33.5 bits (73), Expect = 7.5 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P P P P PP +PPP P P PP P P P Sbjct: 473 PTPTPTPSPPPSPPPSPPPSPPPSPPPSP--PPSPPPSPPPSPPPSPPPSPPSPPPSPPP 530 Query: 818 XXPP 829 PP Sbjct: 531 SPPP 534 Score = 33.5 bits (73), Expect = 7.5 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P P P P PP +PPP P P PP P P P Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSP--PPSPPPSPPPSPPPSPPSPPPSPPPSPPP 534 Query: 818 XXPP 829 PP Sbjct: 535 SPPP 538 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 35.9 bits (79), Expect = 1.4 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPPP APPP P P P P P Sbjct: 325 PPPPPSRGSAPPPP---PARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA 381 Query: 818 XXPP 829 PP Sbjct: 382 APPP 385 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP--XXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P P Sbjct: 383 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 424 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P PP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 1951 PPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP P PP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PP P P + P Sbjct: 53 PPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQP 92 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP APPP P P PP Sbjct: 693 PPPPPTHAAHPPPPPPTAGHDGQAPPPLP--PLSHPP 727 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAPPPPP 1082 >UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 996 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P+ P PPP PPPP PPP P P PP Sbjct: 938 PQPPSPPPPP--PPPPPSLIPFGASPPPPPPPPPPPPPPP 975 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 435 PPPPPPPPPPPSPPAPPPPPPPPVITPPPPPP 466 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 437 PPPPPPPPPSPPAPPPPPPPPVITPPPPPPTP 468 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 35.9 bits (79), Expect = 1.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P PP P P Sbjct: 229 PPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPP 276 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 248 PPPPPPPPSSSLPPPPPPPPPSSTRPPPPPP 278 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 225 PSPPPPPPPSHTPAPPPPSHTPAPPPPPPPP 255 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 35.9 bits (79), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P P Sbjct: 334 PGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 647 PPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PP G PPPP PPP P P + PP P P Sbjct: 331 PPPPGPPPPPPLPSTGPPP--PPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPP--XXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 333 PPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 35.9 bits (79), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PP P P PP Sbjct: 60 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP P P P P PP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP PPPP PPP P P PP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPP 93 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXK 739 P P PPP PPPP PPP P P + Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR 102 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P G PPPP PPP P P PP Sbjct: 504 PPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPP 543 >UniRef50_Q66J90 Cluster: MGC81602 protein; n=3; Xenopus|Rep: MGC81602 protein - Xenopus laevis (African clawed frog) Length = 1938 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P T P Sbjct: 654 PPLPPPPPPQSGFPMPPPLP-------PPPPPTHPSVTVP 686 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 35.5 bits (78), Expect = 1.9 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PPPP PPP P P PP P P Sbjct: 169 PYFPPPPPL----PPPPFPLFPLFPPPPPPPPPPPFSPPPPPSPPPSLFSPPPFFSPPPS 224 Query: 809 XXXXXPP 829 PP Sbjct: 225 FPPLPPP 231 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 35.5 bits (78), Expect = 1.9 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PPP PP PP PPP P P PP P P P Sbjct: 152 PPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPP-PHPPNQPPPPYPPSQPPP 210 Query: 806 XXXXXXPP 829 PP Sbjct: 211 FSPPPSPP 218 Score = 34.7 bits (76), Expect = 3.2 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXX--PXKXPPXXXXXXXPXXP 781 P PPP PPPP +PPP P P PP P P Sbjct: 189 PSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLP 238 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PPPP PPP P P PP P P Sbjct: 123 PSIPSPSPVPS--PPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPP 171 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPP P PP PPP P + P Sbjct: 153 PPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPP 192 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG P PP GPPP P Sbjct: 679 PPPPPPPPGGGPPPPP-------GGGPPPPP 702 >UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structural protein; n=3; Oryza sativa|Rep: Putative glycine-rich cell wall structural protein - Oryza sativa subsp. japonica (Rice) Length = 321 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 GG G G GGG GGGG GGG G RG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 33.9 bits (74), Expect = 5.7 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G GG G G GGG GGGG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Query: 648 GGXGXRG 628 G G G Sbjct: 150 GDDGDNG 156 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G GG G G G G GGGG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Query: 648 GGXGXRG 628 GG G G Sbjct: 143 GGGGGNG 149 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G GG G G GGG GGGG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Query: 648 GGXGXRG 628 G G G Sbjct: 147 GNGGDDG 153 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 8 PAPPSPPPPPS--PPPPPSPAPPSPPPPPPSPPPPSPPPP 45 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP PPPP APP P P PP Sbjct: 5 PPPPAPPSPPPPPSPPPPPSPAPPSPPPPPPSPPP 39 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP P PP PPP P Sbjct: 15 PPPSPPPPPSPAPPSPPPPPPSPPPPSPPPPP 46 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP G P PP PPP P Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPPPP P PP PPP P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALP 309 >UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 674 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P PPP PPPP PPP P P P Sbjct: 312 PPPPPPPSSPPPPPPPSPPRVPFLPPPPPPPPLSPP 347 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 628 PPXPPPPPXXG--GXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP G P PP PPP P T P Sbjct: 565 PPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGP 606 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXXG---GXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G G P PP G PP P Sbjct: 606 PPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPP 640 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGP 711 PP PPPPP G P PP GP Sbjct: 624 PPPPPPPPGQKGIPPPPPTFGGANAKGP 651 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 35.5 bits (78), Expect = 1.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P G PPPP PPP P P P Sbjct: 497 PMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMP 536 Score = 34.7 bits (76), Expect = 3.2 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +2 Query: 638 PXPPPXXG-XXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXX 814 P PPP PPPP PPP P P PP P P P Sbjct: 449 PPPPPLPATQAPPPPPLPATSAPPPPPPAPPAP-PAPPLPAAHAPPPPPPMPPMPAPSGG 507 Query: 815 XXXPP 829 PP Sbjct: 508 APPPP 512 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P PPP P PP PPP P P P P P P Sbjct: 466 PATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPP 525 Query: 809 XXXXXPP 829 PP Sbjct: 526 PPPPPPP 532 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G PP PPP P Sbjct: 510 PPPPPPPPGGMGGVPPPPPPPPPGGMPPPPAP 541 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP PPP P P P P P Sbjct: 100 PPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPP 147 Score = 33.9 bits (74), Expect = 5.7 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P+ P PPP PPPP PPP P P P P P Sbjct: 121 PQYPPPPP----PPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPP 167 >UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 438 Score = 35.5 bits (78), Expect = 1.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 GG G G GGG GGGG GGG G RG Sbjct: 365 GGGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGRG 404 >UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 307 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPP-PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP P PPPP PPP P P PP Sbjct: 57 PSTPRPPSPSNPQPPPPPSPSSQAPGPTPPPPPSEPSSPPP 97 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 35.5 bits (78), Expect = 1.9 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXP--PPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP P PPPP GG P PP PPP P Sbjct: 353 PPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPP 386 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPP----XPXXPXKXPP 748 PR P PP G PPPP PPP P P PP Sbjct: 356 PRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 >UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pombe|Rep: Formin-3 - Schizosaccharomyces pombe (Fission yeast) Length = 1461 Score = 35.5 bits (78), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPP P GG P PP PPP P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 35.5 bits (78), Expect = 1.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +2 Query: 638 PXPPPXXGX---XPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP P P PP P P Sbjct: 681 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPP 731 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPP 698 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP GG P PPP P Sbjct: 604 PPPPPPPPLPGGTAISPPPPLSGDATIPPPPP 635 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP G PP P Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 12 PPPPPPPPPLGAPPPPPLGAPPPP---PPPGP 40 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP PPP P PP Sbjct: 2 PVPPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPP 38 >UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain binding protein; n=1; Gallus gallus|Rep: PREDICTED: similar to SH3 domain binding protein - Gallus gallus Length = 254 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 9 PPPPPPPPPSGGPPPPP 25 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXP 724 P P PPP G PPPP PPP P Sbjct: 1646 PIPPPPPPPFGAAPPPPPPPCGAPPPPPPPPP 1677 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP PPP P Sbjct: 1648 PPPPPPPFGAAPPPPPPPCGAPPPPPPPPPP 1678 >UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein family, member 3; n=1; Gallus gallus|Rep: WAS/WASL interacting protein family, member 3 - Gallus gallus Length = 407 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 9 PPPPPPPPPSGGPPPPP 25 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 240 PPPPTPPPPPPNMPPPPPPPPNMPPPPPPP-PPPPLSLPP 278 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 242 PPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPP 273 >UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; cellular organisms|Rep: RNP-1 like RNA-binding protein - Solibacter usitatus (strain Ellin6076) Length = 132 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXG 637 GG G G GGG GGGG P GGG G Sbjct: 87 GGGGGGGRGFGGGGGGGRPGGGGGGGGRRPGGGGGGG 123 >UniRef50_A3Q834 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 314 Score = 35.1 bits (77), Expect = 2.4 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP APPP P PP P P P Sbjct: 181 PVPPPPVEAPPPPPPPVE-----APPPPPPPVEAPPPPAVEAPLPPPPVEAAPPPPEEAA 235 Query: 818 XXPP 829 PP Sbjct: 236 PPPP 239 >UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis thaliana|Rep: AT4g18560/F28J12_220 - Arabidopsis thaliana (Mouse-ear cress) Length = 642 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P PPP PPPP PPP P P P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 629 PRXPXPPPXXGXX-PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP APPP P P P P P Sbjct: 277 PTPPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPPPPPP 328 >UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; Pisum sativum|Rep: Putative uncharacterized protein - Pisum sativum (Garden pea) Length = 306 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP 733 R P PPP PPPP PPP P P Sbjct: 76 RSPPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPP 109 >UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster|Rep: CG5225-PA - Drosophila melanogaster (Fruit fly) Length = 594 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PP G PP P PPP P P PP P P Sbjct: 215 PGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPP 262 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 577 PPPPPPPPMLGGPPPPP 593 >UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; Cryptosporidium hominis|Rep: Putative uncharacterized protein - Cryptosporidium hominis Length = 996 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 411 PPPPPPPPPPPPPPPPPLPPSQHLLPPPPPLP 442 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPLPPSQHLLPPPPP 440 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP P PP GPPP P Sbjct: 660 PKQPPPPPPPPPPPPPPPPPPPRMGNGPPPPP 691 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPP PPP P P PP P P Sbjct: 641 PPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPPPP 691 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP P P PPP P P K PP Sbjct: 527 PPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAPGKLPP 566 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 588 PPPPPPPPSGGGAPPPP 604 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 35.1 bits (77), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PR P PPP PPPP PPP P K PP Sbjct: 468 PRTPPPPP-----PPPPGKNAPPPPPPPPPPPPHGKKAPP 502 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXG---PPPXP 723 PP PPPPP P PP G PPP P Sbjct: 471 PPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPP 505 >UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|Rep: Formin 1,2/cappuccino - Aedes aegypti (Yellowfever mosquito) Length = 891 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP P P P P PP Sbjct: 298 PPPPLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPP 337 Score = 35.1 bits (77), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P PPPP PPP P P PP Sbjct: 300 PPLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPP 339 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPP-PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP P PPPP PPP P P PP Sbjct: 417 PSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPP 457 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P P P PPPP PPP P P PP Sbjct: 422 PPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAP-PPXPXXPXKXPP 748 P P PPP PPPP P PP P P PP Sbjct: 416 PPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPP 456 >UniRef50_A2E6V2 Cluster: WH2 motif family protein; n=3; Trichomonas vaginalis G3|Rep: WH2 motif family protein - Trichomonas vaginalis G3 Length = 422 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 292 PPPPPPPPPPGGLPPPP 308 >UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein - Yarrowia lipolytica (Candida lipolytica) Length = 659 Score = 35.1 bits (77), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPP 678 PP PPPPP GG P PP Sbjct: 6 PPPPPPPPGFGGPPPPP 22 >UniRef50_Q0U3V3 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1289 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXXXX 823 PP PPPP APPP P PP P P P Sbjct: 842 PPRKSHDRPPPPPPQAPPHQHAPPPLPGTAAPPPPPPQERAPPPLPPQERQAPPPPPAEA 901 Query: 824 PP 829 PP Sbjct: 902 PP 903 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 35.1 bits (77), Expect = 2.4 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP G PPP PPP P PP P P P Sbjct: 1010 PPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAP 1069 Query: 818 XXP 826 P Sbjct: 1070 PPP 1072 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 922 PPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPP 969 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 933 PPPPPLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 980 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 944 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 991 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 955 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1002 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 966 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1013 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 977 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1024 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 988 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPP 1035 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 999 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPP 1046 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPPPXXG-XXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP G PPPP PPP P PP Sbjct: 894 PAPPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPP 934 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP G PPP PPP P PP P P Sbjct: 908 PPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIPPPP 958 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 35.1 bits (77), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP G PPP PPP P P PP Sbjct: 583 PPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPP 617 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP PP GG P PP PPP P Sbjct: 592 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPP 622 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 640 PPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PPPP GG P P GPPP P Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAP 609 >UniRef50_UPI0000E494ED Cluster: PREDICTED: similar to FIP1 like 1 (S. cerevisiae); n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FIP1 like 1 (S. cerevisiae) - Strongylocentrotus purpuratus Length = 841 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR PPP PPP PPP P PP P P P Sbjct: 519 PRMGGPPPPGPHGPPPMGPPPGGNWNRPPPPFGRPDGPPPPFYDQPLPMGPGMGPGPGPG 578 Query: 809 XXXXXPP 829 PP Sbjct: 579 PGPGGPP 585 >UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L splicing variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FHOS2L splicing variant - Strongylocentrotus purpuratus Length = 1146 Score = 34.7 bits (76), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 628 PPXP----PPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP P PPPP G P PP PPP P T P Sbjct: 586 PPLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPPPIIDSNTFP 629 >UniRef50_UPI00006A1337 Cluster: Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET domain-containing protein 1A).; n=1; Xenopus tropicalis|Rep: Histone-lysine N-methyltransferase, H3 lysine-4 specific SET1 (EC 2.1.1.43) (Set1/Ash2 histone methyltransferase complex subunit SET1) (SET domain-containing protein 1A). - Xenopus tropicalis Length = 1824 Score = 34.7 bits (76), Expect = 3.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXP 724 P PPP G PPPP +PPP P Sbjct: 389 PPPPPTEGWEPPPPPLPPLPPVCSPPPSP 417 >UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep: Enah/Vasp-like a - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 387 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP GPPP P Sbjct: 187 PPAPPPPPGP-PPPGPPPPGPPPPVTGPPPTP 217 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 951 PPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPP 982 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P + PP P P Sbjct: 289 PGPPPPPPLPSAGPPPP----------PPPPPPLPNQVPPPPPPPPAPPLP 329 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 291 PPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPP 322 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPP--XXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 288 PPGPPPPPPLPSAGPPPPPPPPPPLPNQVPPPPP 321 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 34.7 bits (76), Expect = 3.2 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 2/69 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXX--PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXX 802 P P PPP PPPP PPP P P K P P Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVD 2387 Query: 803 PXXXXXXPP 829 P PP Sbjct: 2388 PPPPPPPPP 2396 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXXXX 817 P PPP PPPP PPP P PP P P P Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPP---PPPPPPPPKVKKVDPPPPPP 2377 Query: 818 XXPP 829 PP Sbjct: 2378 PPPP 2381 >UniRef50_Q8S9B5 Cluster: Matrix metalloproteinase; n=1; Volvox carteri f. nagariensis|Rep: Matrix metalloproteinase - Volvox carteri f. nagariensis Length = 625 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 3/54 (5%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPP---XXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PR P PPP PPPP PP P P PP P P Sbjct: 560 PRSPLPPPRPPTSPPPPPQLKASKAPRFPTPPQKPRPPRPPPPPRPPPRRPSSP 613 >UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=3; Oryza sativa (japonica cultivar-group)|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 1779 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP PPP P PP P P Sbjct: 1355 PAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPPPPPPCPPAPP 1405 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PPPP A P P P PP P P Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 PPP G PPP +PPP P P PP P P Sbjct: 62 PPPAAGPLMPPPPPPPSVTS-SPPPPPLPPPPPPPAASPPPPPPSP 106 Score = 33.1 bits (72), Expect = 9.9 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PP PPPP A PP P P PP P P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP--PPSPPPPSPVKSSPPPP 119 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 34.7 bits (76), Expect = 3.2 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP PP P PPP P P P P P P Sbjct: 785 PPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPS-PSPSPPPPSPPPPSPPPPSPPP 843 Query: 809 XXXXXPP 829 PP Sbjct: 844 PSPFPPP 850 Score = 33.1 bits (72), Expect = 9.9 Identities = 17/66 (25%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P P P PPP +PPP P PP P P P Sbjct: 799 PSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPP 858 Query: 809 XXXXXP 826 P Sbjct: 859 PADECP 864 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 628 PPXPPPPPXXG-GXPXPPXXXXXXXXXGPPP 717 PP PPPPP G G P PP PPP Sbjct: 89 PPPPPPPPSSGSGPPKPPPPSHSNSSPPPPP 119 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP--PPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PP PP PPP P P PP P P Sbjct: 53 PSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKP 105 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PPP P Sbjct: 88 PPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPP 119 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/67 (26%), Positives = 18/67 (26%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP P PP P P P PP P P P Sbjct: 261 PYPPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPP 320 Query: 809 XXXXXPP 829 PP Sbjct: 321 PPPPPPP 327 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP P PP PPP P P PP Sbjct: 296 PPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPP 332 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 638 PXPPPXXGXX--PPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP G PPPP PPP P P PP Sbjct: 548 PPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPP 586 Score = 33.9 bits (74), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPP 714 PP PPPPP G P PP PP Sbjct: 560 PPPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 33.5 bits (73), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G PP PPP Sbjct: 559 PPPPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G PP PPP Sbjct: 558 PPPPPPPPPPPGAGAPPPPPPPGPGLAPPP 587 >UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 460 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 338 PAAPPPPPAPAAPPPPP----APAAPPPPPPPSVPAPPPP 373 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP G P PP GPPP P Sbjct: 545 PPGPPPAMSGGPPPPPPPPGDFGVTPGPPPPP 576 >UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=3; Pezizomycotina|Rep: Adenylyl cyclase-associated protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 546 Score = 34.7 bits (76), Expect = 3.2 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 637 PPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PPPPP GG P PP GPPP P Sbjct: 284 PPPPPPAGGIPPPP---GPPPPPGPPPPP 309 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 34.7 bits (76), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPP 714 PP PPPPP G P PP PP Sbjct: 1308 PPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 Score = 33.1 bits (72), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPP 717 PP PPPPP G P PP PP Sbjct: 1307 PPPPPPPPPGMGAPPPPPMPPMGGAPAAPP 1336 >UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 795 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP PP APPP P P PP P P Sbjct: 390 PPPPPIPSSLPPSIPSSLPARNTAPPPPPAPPAPPPPPINSGPPPPPP 437 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P P PPP P Sbjct: 1291 PPPPPPPPPPGPPPIPNAPFGAPPPPPPPPGP 1322 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 644 PPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP PP P APPP P P PP Sbjct: 1291 PPPPPPPPPPGPPPIPNAPFGAPPPPPPPPGPPPP 1325 >UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Additionally; n=5; Trichocomaceae|Rep: Similarity to the N. crassa protein. Additionally - Aspergillus niger Length = 578 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPP G P PP PPP P Sbjct: 492 PPPPPPPNYQGTWPPPPPPAMNLGAAHPPPPP 523 >UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precursor; n=14; root|Rep: Vegetative cell wall protein gp1 precursor - Chlamydomonas reinhardtii Length = 555 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P+ P PPP PPPP PP P P P Sbjct: 259 PKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSP 297 >UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin - Gallus gallus (Chicken) Length = 1213 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 655 PPPPPPPPPPPPPPPPPFSDSSLPGLVPPPPP 686 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1086 PPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPP 1133 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1155 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1119 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1166 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1130 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1177 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1141 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1188 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1152 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1199 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1163 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1210 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1174 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1221 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1185 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1232 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1196 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1243 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1207 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPP 1254 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1218 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1265 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1229 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1276 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1240 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1287 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1251 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPP 1298 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1262 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPP 1309 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1273 PPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1320 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1342 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1306 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPP 1353 Score = 34.7 bits (76), Expect = 3.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP PPP P PP P P Sbjct: 1317 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAP 1364 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 34.7 bits (76), Expect = 3.2 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PPP P P + PP P P Sbjct: 565 PGPPPPPPLPSTGPPPP----------PPPPPPLPNQAPPPPPPPPAPPLP 605 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPP P G P PP PPP P Sbjct: 567 PPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPP 598 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 628 PPXPPPPP--XXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP PPP P Sbjct: 564 PPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPP 597 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 34.7 bits (76), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 P PPPPP GG PP PPP P Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGP 580 >UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 100 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXR 631 G G GG G G GGG GGGG GGG G R Sbjct: 30 GVGGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGSGLR 79 >UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor; n=2; Rattus norvegicus|Rep: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor - Rattus norvegicus Length = 542 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P K PP Sbjct: 411 PPPPVPPPTPPPPPPPPPP--------PPPPPPPPVKAPP 442 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXR 631 G G GG G G GGG GGGG GGG G R Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 232 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSG 234 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GG G RG Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 231 >UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein; n=3; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 170 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXR 631 G G GG G G GGG GGGG GGG G R Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 100 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXR 631 G G GG G G GGG GGGG GGG G R Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 >UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01070.1 - Gibberella zeae PH-1 Length = 217 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 50 PPLPPPPPPQFYPPPPPPPVIEVPCSPPPPPP 81 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 632 RXPXPP-PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 R P PP P PPPP +PPP P P + P Sbjct: 49 RPPLPPPPPPQFYPPPPPPPVIEVPCSPPPPPPPPVEKP 87 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPPPP G PP PPP P + P Sbjct: 640 PSVPPPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVP 679 Score = 33.5 bits (73), Expect = 7.5 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 638 PXPPPXXGXX--PPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPPP PPP P PP P P Sbjct: 655 PPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPP 704 >UniRef50_Q6NWB3 Cluster: Splicing factor 3b, subunit 4; n=16; Eumetazoa|Rep: Splicing factor 3b, subunit 4 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 400 Score = 34.3 bits (75), Expect = 4.3 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 629 PRXPXPPP-XXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXP 805 P P PP G PPPP APPP P PP P P P Sbjct: 295 PHMPMPPTGPPGMVPPPPGPPGSNQPRAPPPPQMPP---PPMGVPPRGPFGPPMGPPMHP 351 Query: 806 XXXXXXPP 829 PP Sbjct: 352 GMRGPPPP 359 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 628 PPXPPPPPXXGGXP----XPPXXXXXXXXXGPPPXP 723 PP PPPPP G P PP GPPP P Sbjct: 88 PPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPPP 123 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP APPP P P + PP Sbjct: 106 PSMPPPPPPRR-APPPPATPPPPPRRAPPP-PSPPIRPPP 143 Score = 33.9 bits (74), Expect = 5.7 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR PPP PPPP PPP P P P P P Sbjct: 99 PRRAPPPP--SMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPS 156 Query: 809 XXXXXPP 829 PP Sbjct: 157 HPLAPPP 163 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP G PP P Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >UniRef50_Q3E7G7 Cluster: Uncharacterized protein At5g19090.2; n=3; Arabidopsis thaliana|Rep: Uncharacterized protein At5g19090.2 - Arabidopsis thaliana (Mouse-ear cress) Length = 465 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 722 GXGGGPXXXXXXXXLGGXGXPPXXGGGGGXGG 627 G GGGP +GG G GGGGG GG Sbjct: 108 GGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PP P GG P PP PPP T P Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPP 1175 >UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA sequence - Ostreococcus tauri Length = 281 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 113 PPPPSPPPPS---PPPPSPPSPPPPSPPPPSPPPPSPPPP 149 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 118 PPPPSPPPPSPPSPPPPSPPPPSP---PPPSPPPPSPPPP 154 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXK 739 P PPP PPPP PPP P P K Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPVK 76 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP P P PP Sbjct: 14 PLSPPPPPPSPSPPPPPSPSPSPP---PPPSPSPPPSPPP 50 Score = 33.1 bits (72), Expect = 9.9 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP +PPP P P PP Sbjct: 26 PPPPPSPSPSPPPP------PSPSPPPSPPPPSSPPP 56 >UniRef50_A5AEG8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 300 Score = 34.3 bits (75), Expect = 4.3 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 4/71 (5%) Frame = +2 Query: 629 PRXPXPP----PXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXX 796 P P PP P PPPP +PPP P K P P P Sbjct: 60 PTSPSPPKVAPPHQPIRPPPPPTPSFPTPASPPPTSPSPPKVAPPHQPIRAPPPPSFPTP 119 Query: 797 XXPXXXXXXPP 829 P PP Sbjct: 120 AAPPHHSFPPP 130 >UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 722 Score = 34.3 bits (75), Expect = 4.3 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G G G G GGG GGGG G Sbjct: 121 GGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGG 180 Query: 648 GGXGXRG 628 GG G G Sbjct: 181 GGTGGNG 187 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 GG G G GGG GGGG GGG G G Sbjct: 97 GGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNG 136 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 828 GGXXXXXXGXXXXXXXGXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXG 649 GG G G G GG G G GGG GGGG G Sbjct: 125 GGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTG 184 Query: 648 GGXGXRG 628 G G G Sbjct: 185 GNGGDGG 191 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 722 GXGGGPXXXXXXXXLGGXGXPPXXGGGGGXG 630 G GGGP GG PP GGGGG G Sbjct: 112 GGGGGPPSLPPGAGGGGGARPPAPGGGGGGG 142 >UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila melanogaster|Rep: CG5514-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 1150 Score = 34.3 bits (75), Expect = 4.3 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PP PPPP PPP P PP P P P Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPP 484 Query: 809 XXXXXP 826 P Sbjct: 485 PPPAPP 490 Score = 33.5 bits (73), Expect = 7.5 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 PR PPP PPPP PPP P P PP P P Sbjct: 390 PRFDPPPPHTIEPPPPP----APPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPT 445 Query: 809 XXXXXPP 829 PP Sbjct: 446 VEPPPPP 452 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 + P PP PPPP PPP P P K P Sbjct: 423 KPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP 461 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P PPP G PPP APP P PP P P Sbjct: 263 PPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPP 310 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PPPPP P PP PPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPP 414 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP PPP K PP Sbjct: 384 PPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPP 423 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP---PPXXXXXXXXXAPPPXPXXP 733 P P PPP G PP PP APPP P P Sbjct: 392 PPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPP 429 >UniRef50_Q19079 Cluster: Dumpy : shorter than wild-type protein 3; n=2; Caenorhabditis|Rep: Dumpy : shorter than wild-type protein 3 - Caenorhabditis elegans Length = 302 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXP 723 PP PP PP G P PP GPP P Sbjct: 226 PPGPPGPPGPQGPPGPPGKDGQPGKAGPPGLP 257 >UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_56, whole genome shotgun sequence - Paramecium tetraurelia Length = 964 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXP 733 P P PP G PPPP PPP P P Sbjct: 390 PPPPLPPSQSGNRPPPPPPLLTKTGNPPPPPPLPP 424 >UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: KIAA1856 protein - Homo sapiens (Human) Length = 1134 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-PXPXXPXKXPP 748 P P PPP PPPP PP P P P PP Sbjct: 955 PPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPP 995 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 629 PRXPXPPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXP 745 P P PPP PP PP APPP P P P Sbjct: 786 PPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRP 825 >UniRef50_Q2U6G9 Cluster: Predicted protein; n=5; Trichocomaceae|Rep: Predicted protein - Aspergillus oryzae Length = 765 Score = 34.3 bits (75), Expect = 4.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 GG G G GGGA GGGG GGG G G Sbjct: 721 GGGAAGGCGSGGGAGCGGSSSGGGGGGGCGGGGGGGGCGG 760 >UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 580 Score = 34.3 bits (75), Expect = 4.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGP-PPXP 723 P PPPPP G P PP GP PP P Sbjct: 510 PPPPPPPPPGTPPPPPPPGSPPDTPGPGPPHP 541 Score = 33.9 bits (74), Expect = 5.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPP-PXP 723 PP PPPPP P PP GPP P P Sbjct: 511 PPPPPPPPGTPPPPPPPGSPPDTPGPGPPHPGP 543 >UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 34.3 bits (75), Expect = 4.3 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 P P PPP G P PP APP P P PP P P P Sbjct: 543 PAPPKPPP-FGEPPAPPRPPAPPRPPAPPKPP--PFGKPPAPPKPPAPPKPPAPPKPPPF 599 Query: 809 XXXXXPP 829 PP Sbjct: 600 GKPPGPP 606 Score = 33.1 bits (72), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PP PPPP PP P P + PP Sbjct: 403 PPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPP 442 >UniRef50_Q8ZU13 Cluster: Putative uncharacterized protein PAE2992; n=4; Pyrobaculum|Rep: Putative uncharacterized protein PAE2992 - Pyrobaculum aerophilum Length = 157 Score = 34.3 bits (75), Expect = 4.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPP PPP P P + PP Sbjct: 38 PPPPPAPYPIPPPTVVRTQRTMPPPPPPPLMPQQPPP 74 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P P P PPPP P P P K PP P P Sbjct: 403 PPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPP 453 Score = 33.5 bits (73), Expect = 7.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 644 PPPXXGXXPP-PPXXXXXXXXXAPPPXPXXPXKXPP 748 PPP G PP PP PPP P P PP Sbjct: 441 PPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPP 476 Score = 33.1 bits (72), Expect = 9.9 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPP-XPXXPXKXPPXXXXXXXPXXPXXXXXXXPX 808 R P PP G PP P PPP P P PP P P P Sbjct: 372 RPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPA 431 Query: 809 XXXXXP 826 P Sbjct: 432 PSGDKP 437 Score = 33.1 bits (72), Expect = 9.9 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 632 RXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXPXXXXXXXPXX 811 R P PP G PP P PPP P P P P P P Sbjct: 610 RPPPGPPPPGPPPPGPAPPGARPPPGPPP-PGPPPPGPAPPGARPPPGPPPPPPGPSPPR 668 Query: 812 XXXXPP 829 PP Sbjct: 669 PPPGPP 674 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 34.3 bits (75), Expect = 4.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P P PPP PPPP A PP P P PP Sbjct: 909 PPPPLPPPSSAGPPPPPPPPPLPNSPA-PPNPGGPPPAPP 947 Score = 33.5 bits (73), Expect = 7.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 628 PPXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 PP PPPPP P PP GPPP P P Sbjct: 921 PPPPPPPPPLPNSPAPP------NPGGPPPAPPPPGLAPP 954 >UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP00000010144; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000010144 - Nasonia vitripennis Length = 483 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPP 748 P PPP PPPP APPP P P PP Sbjct: 183 PPPPPPAAAAPPPPSH-------APPPPPPPPASAPP 212 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 33.9 bits (74), Expect = 5.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPP P P P P PP P P Sbjct: 496 PPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPP 546 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 631 PXPPPPPXXGGXPXPPXXXXXXXXXGPPPXPXXXXXTXP 747 P PPPPP P PP PPP P + P Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTP 102 Score = 33.5 bits (73), Expect = 7.5 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 5/56 (8%) Frame = +2 Query: 629 PRXPXPPPXXGXXPPPPXXXXXXXXXAPP-----PXPXXPXKXPPXXXXXXXPXXP 781 P P PPP PPPP PP P P P PP P P Sbjct: 489 PPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPP 544 >UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 143 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGG 52 >UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 236 Score = 33.9 bits (74), Expect = 5.7 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 780 GXXGXXXXXXXGGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 G G GG G G GGG GGGG GGG G G Sbjct: 74 GGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 33.1 bits (72), Expect = 9.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 747 GGXXXGXXGXGGGAXXXXXXXXXGGGGXXPXXGGGXGXRG 628 GG G G GGG GGGG GGG G G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 126 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 33.9 bits (74), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 638 PXPPPXXGXXPPPPXXXXXXXXXAPPPXPXXPXKXP 745 P PPP G PPP PPP P P P Sbjct: 725 PPPPPLFGGAVPPPPPLPGGGAGPPPPPPGGPPMAP 760 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,279,408 Number of Sequences: 1657284 Number of extensions: 11655954 Number of successful extensions: 132233 Number of sequences better than 10.0: 353 Number of HSP's better than 10.0 without gapping: 35665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78179 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81161904978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -